Entry information : AdelCIIBA02 (GP2)
Entry ID 9707
Creation 2011-11-16 (Christophe Dunand)
Last sequence changes 2011-11-16 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2015-02-02 (Christophe Dunand)
Peroxidase information: AdelCIIBA02 (GP2)
Name (synonym) AdelCIIBA02 (GP2)
Class Other class II peroxidase type A    [Orthogroup: CIIBA002]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Auriculariaceae Auricularia
Organism Auricularia delicata    [TaxId: 160860 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AdelCIIBA02
start..stop
S start..stop
AdelCIIBA03 675 0 26..366 25..365
AdelCIIBA04 623 0 1..364 1..364
AdelCIIBA10 617 0 23..364 23..364
AdelCIIBA08 609 0 23..364 22..363
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 495468..495516 49 N° 2 495568..495623 56 N° 3 495674..495691 18 N° 4 495747..495772 26
N° 5 495824..495966 143 N° 6 496017..496059 43 N° 7 496110..496251 142 N° 8 496299..496318 20
N° 9 496378..496385 8 N° 10 496434..496646 213 N° 11 496700..496798 99 N° 12 496846..496946 101
N° 13 496997..497071 75 N° 14 497124..497191 68 N° 15 497245..497284 40  
join(495468..495516,495568..495623,495674..495691,495747..495772,495824..495966, 496017..496059,496110..496251,496299..496318,496378..496385,496434..496646,49670 0..496798,496846..496946,496997..497071,497124..497191,497245..497284)


exon

Literature and cross-references AdelCIIBA02 (GP2)
DNA ref. JGI genome:   scaffold_11 (495468..497284)
Protein sequence: AdelCIIBA02 (GP2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   366 (349)
PWM (Da):   %s   38721.3 (37159.4)  
PI (pH):   %s   4.63 (4.63) Peptide Signal:   %s   cut: 26 range:18-366
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MIAAPLIALALAAVTAAAPAAGVCADGVHTTVNPCCFWANVRDRFINEIFLNVCKENVHSLVRIAFHDAIGFSLHSNKGGGADGSMIQFGDSELKHANEGIDFITAFLQPFADTVGITYGDAIQFGAAVGLSLCPGAPRIPAFVGRPNATQAAPDKVPEPDDDPTIFARMADAGFTPVELVHLLASHSIADQAGVDPEDVVLGAPFDSTPFSFDSQVFLEVMLRGTLFPGSGPNPGEELSPLPGEFRLLSDRVFARHNETACAWQENALSQSTMASNFQTAFSKLSLLGHNKNDLLDCSEVGTPPPPTAKQAFFPPGKSHADIEQGCATQLFPTTLVTMQGQPTKIPTVQVQDIAFGRKRK

Retrieve as FASTA  
Remarks Complete sequence from genomic (14 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATCGCCGCGCCCCTCATCGCTCTCGCTCTCGCAGCGGTCACCGCTGGTACGATTATACGCCACTCGAGTCGACGTTGCCGCTGACTACTCGGTCCAGCCGCGCCTGCTGCCGGCGTC
TGTGCGGATGGCGTCCACACCACGGTCAACCCGCAG
GTACGCGCACACTTAGAATACGAGAGGATTCTTACTCATGTCTCCTGCAGTGCTGCTTCTGGGCGAATGTAAGAATGATCCCCC
CGTAGATCCCGTGCCATTGCTTAACAAGTCGTCTTCCAGGTCCGCGACAGGTTCATCAACGAGATGTGCGTCAAACCAATTCTGCACGACTTCGCTCGAGACTGAATGTTCTTCAGCTTC
CTGAACGTCTGCAAGGAAAACGTGCACTCGCTCGTCCGCATCGCCTTCCACGATGCCATCGGCTTCTCCCTGCACTCGAACAAGGGCGGAGGTGCTGACGGAAGCATGATCCAGTTCGGC
GACAGCGAGCTCAAATTCC
GTGCGCATGAGCGCTTGCCACTGATGTCCCTCGTCTGACAGCCTTTTTAGACGCAAACGAGGGCATCGACTTCATCACCGCATTCCTCCAGCCGTAAGCGA
TCCCTTCAATAGTGGCACGGCAGTCTCAACTCTGGCTTTCAGGTTCGCTGACACCGTCGGCATCACCTACGGAGACGCCATCCAGTTCGGCGCGGCTGTCGGTCTCTCGCTCTGCCCCGG
TGCCCCGCGCATCCCCGCTTTCGTGGGCCGCCCGAATGCCACTCAGGCCGCGCCGGACAAGACT
GTGAGTCTTTTATTCGGCGGTACTGATGGTCTCTGATCGTATACAAGGTGCCTGAG
CCCGATGACGA
GTACGTGGTACAGCTGACTGAACTCGCCCCTTCCTTACCTGAGATATACCCAATCTCAGCCCGACCAGTCAGTCGCAACGTTAAATTAGTAGAGCGTTAGCTAACGCTG
TGATAGCCATCTTCGCGCGCATGGCCGATGCTGGCTTCACGCCCGTGGAGTTGGTACACCTTCTCGCGTCTCACAGTATTGCCGACCAGGCGGGCGTGGACCCGGAGGACGTCGTCCTTG
GCGCGCCGTTCGATTCGACACCGTTCAGCTTCGACTCGCAGGTCTTCCTCGAGGTCATGCTGCGCGGCACCCTGTTCCCCGGCTCTGGTCCCAACCCCG
GTTCGTCACGTCGCTAGATCG
TCCCGTTTCTCAGTCGTTAAACCGACGCTCAGGTGAGGAACTGAGCCCTCTTCCGGGCGAATTCCGTCTTCTCTCGGACCGTGTCTTCGCCCGCCACAACGAGACGGCTTGCGCGTGGCA
GGAGAACGCTC
GTAAGTTCCCACACTGCCTTGTGGTCATCCTCTGAGTGCCTCGCAAGTGAGCCAGTCTACCATGGCGTCGAACTTCCAGACGGCGTTCAGCAAGCTTTCGCTTCTCGGC
CACAACAAGAACGATCTCCTTGACTGCAGCGAAGTCATT
GTGCGTCTCTTCACGTATTGGTTCGTGCTCGCCCTGAGGCAATTTTATAGGGCACGCCCCCGCCCCCGACGGCGAAGCAGG
CCTTCTTCCCGCCGGGAAAGAGCCACGCCGACATCGAGCAGGGC
GTGCGTTGTAACTGCATCCTCATCGCGGGATCTTACTCATTGGCCCGATTAGTGTGCGACGCAACTCTTCCCGACG
ACGCTGGTGACAATGCAAGGCCAGCCCACGAAGATCCCCACTGT
GTACGTGGTTTACTTCACGCATAGCAATTTGTGGTCTCAAGTTTATCACACAGGCAAGTCCAGGACATCGCGTTCG
GCCGCAAGAGGAAGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATCGCCGCGCCCCTCATCGCTCTCGCTCTCGCAGCGGTCACCGCTGCCGCGCCTGCTGCCGGCGTCTGTGCGGATGGCGTCCACACCACGGTCAACCCGCAGTGCTGCTTCTGGGCG
AAT
GTCCGCGACAGGTTCATCAACGAGATCTTCCTGAACGTCTGCAAGGAAAACGTGCACTCGCTCGTCCGCATCGCCTTCCACGATGCCATCGGCTTCTCCCTGCACTCGAACAAGGGC
GGAGGTGCTGACGGAAGCATGATCCAGTTCGGCGACAGCGAGCTCAAATTCC
ACGCAAACGAGGGCATCGACTTCATCACCGCATTCCTCCAGCCGTTCGCTGACACCGTCGGCATCACC
TACGGAGACGCCATCCAGTTCGGCGCGGCTGTCGGTCTCTCGCTCTGCCCCGGTGCCCCGCGCATCCCCGCTTTCGTGGGCCGCCCGAATGCCACTCAGGCCGCGCCGGACAAGACT
GTG
CCTGAGCCCGATGACGA
CCCGACCACCATCTTCGCGCGCATGGCCGATGCTGGCTTCACGCCCGTGGAGTTGGTACACCTTCTCGCGTCTCACAGTATTGCCGACCAGGCGGGCGTGGAC
CCGGAGGACGTCGTCCTTGGCGCGCCGTTCGATTCGACACCGTTCAGCTTCGACTCGCAGGTCTTCCTCGAGGTCATGCTGCGCGGCACCCTGTTCCCCGGCTCTGGTCCCAACCCCG
GT
GAGGAACTGAGCCCTCTTCCGGGCGAATTCCGTCTTCTCTCGGACCGTGTCTTCGCCCGCCACAACGAGACGGCTTGCGCGTGGCAGGAGAACGCTC
TGAGCCAGTCTACCATGGCGTCG
AACTTCCAGACGGCGTTCAGCAAGCTTTCGCTTCTCGGCCACAACAAGAACGATCTCCTTGACTGCAGCGAAGTCATT
GGCACGCCCCCGCCCCCGACGGCGAAGCAGGCCTTCTTCCCG
CCGGGAAAGAGCCACGCCGACATCGAGCAGGGC
TGTGCGACGCAACTCTTCCCGACGACGCTGGTGACAATGCAAGGCCAGCCCACGAAGATCCCCACTGTGCAAGTCCAGGACATCGCG
TTCGGCCGCAAGAGGAAGTAG

Retrieve as FASTA