Entry information : AdelCIIBA03 (GP3)
Entry ID 9708
Creation 2011-11-16 (Christophe Dunand)
Last sequence changes 2011-11-16 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2015-02-02 (Christophe Dunand)
Peroxidase information: AdelCIIBA03 (GP3)
Name (synonym) AdelCIIBA03 (GP3)
Class Other class II peroxidase type A    [Orthogroup: CIIBA002]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Auriculariaceae Auricularia
Organism Auricularia delicata    [TaxId: 160860 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AdelCIIBA03
start..stop
S start..stop
AdelCIIBA02 680 0 23..365 24..366
AdelCIIBA10 624 0 23..363 24..364
AdelCIIBA04 622 0 1..363 1..364
AdelCIIBA08 619 0 22..363 22..363
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 528233..528281 49 N° 2 528130..528182 53 N° 3 528061..528078 18 N° 4 527980..528005 26
N° 5 527784..527926 143 N° 6 527687..527729 43 N° 7 527495..527636 142 N° 8 527428..527447 20
N° 9 527361..527368 8 N° 10 527100..527312 213 N° 11 526946..527044 99 N° 12 526793..526893 101
N° 13 526665..526739 75 N° 14 526549..526616 68 N° 15 526456..526495 40  
complement(join(526456..526495,526549..526616,526665..526739,526793..526893,5269 46..527044,527100..527312,527361..527368,527428..527447,527495..527636,527687..5 27729,527784..527926,527980..528005,528061..528078,528130..528182,528233..528281 ))


exon

Literature and cross-references AdelCIIBA03 (GP3)
DNA ref. JGI genome:   scaffold_11 (528281..526456)
Protein sequence: AdelCIIBA03 (GP3)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   365 (348)
PWM (Da):   %s   38544.17 (36976.3)  
PI (pH):   %s   4.51 (4.51) Peptide Signal:   %s   cut: 18 range:18-365
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MIAAPLVALGLAAAAYAAPAATCADGVHTAINPCCFWANVRDRFINEIFLNVCKENVHSLVRIAFHDAIGFSLHSNKGGGADGSMIQFGDVELAHANEGIDFITAFLQPFADTVGITYGDAIQFGAAVGLSLCPGAPRIPAFVGRPNATQAAPDKVPEPDDDPTIFARMADAGFTPVELVHLLASHSIADQAGVDPEDVVLGAPFDSTPFSFDSQVFLEVMLRGTLFPGSGPNPGEELSPLPGEFRLLSDRVFARHTETACAWQENALSQSAMASNFQTAFSKLSLLGHDKNSLLDCSELGTPPPATAKQAFFPPGKTHDDIEQGCATQLFPTTLVTMAGQPTKIPVVQVQDIAFGRKRK

Retrieve as FASTA  
Remarks Complete sequence from genomic (14 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATCGCTGCGCCACTCGTCGCTCTTGGCCTCGCAGCCGCTGCCTATGGTATGCATGTTGAGCCCTGGACTCTGTCCCGAGTGCTGATAGTCTCTCAGCTGCGCCCGCTGCAACCTGCG
CCGACGGCGTGCACACCGCAATAAACCCTCAG
GTTCGCTCGTTGCCTAAGTCATTTCCTCTGAATATTGAACATCCTGCACAGTGTTGCTTCTGGGCCAATGTGAGCCCCAATCTCGCCC
AGCAGCCTCGCTCTTCTAACAGTGCCATTGCCCTAGGTCCGCGACAGATTCATCAACGAAATGTATGTTTCCCTTTCCCTTTGCGCATTACCCCGCCGACTAACCGCAATCGCAGCTTCC
TCAATGTCTGCAAGGAGAACGTGCACTCGCTCGTGCGGATCGCGTTCCACGACGCCATCGGCTTCTCTCTACACTCGAACAAGGGCGGAGGAGCAGACGGGAGCATGATCCAATTCGGCG
ACGTTGAGCTTGCATACC
GTGAGTCTCATGCACCGGCTAAGTTGTTTTAACGTCGTCTCACGTCCTCCAAAGATGCGAACGAGGGCATCGACTTCATCACGGCGTTCCTGCAACCGTGGG
TGTCACCTCAGAGGGCCCTGCACGCTGCTCATGGTTGGGACGTAGCTTCGCTGACACCGTCGGAATCACCTACGGTGACGCCATCCAATTCGGTGCAGCAGTCGGTCTCTCGCTCTGCCC
TGGTGCTCCGCGCATCCCCGCTTTCGTGGGCCGCCCGAATGCCACTCAGGCTGCCCCGGACAAGACT
GTGAGTCTTTTATTCGGCGGTACTGATGGTCTCTGATCGTATACAAGGTGCCT
GAGCCCGATGACGA
GTACGTGGTACAGCTAACTGAACTCGCCCCTTCCTTACCTGAGATATACCCAATCTCAGCCCGACCAGTCAGTCACAACTTTGAATTAGTAGAGCGTATGCTAACA
CTGTGATAGCCATCTTCGCACGCATGGCCGATGCTGGCTTCACGCCCGTGGAGTTGGTACACCTTCTCGCGTCGCACAGCATTGCCGACCAGGCCGGCGTGGACCCGGAGGACGTCGTCC
TCGGCGCACCGTTCGACTCGACACCGTTCAGCTTCGACTCGCAGGTCTTCCTCGAGGTCATGCTGCGCGGTACCCTGTTCCCCGGCTCTGGTCCCAACCCTG
GTTCGTCGTGTCGCCATG
TTGCCCCGCTCCAGTTAGTCGCTAAACCCACGCTCAGGTGAGGAACTGAGCCCTCTTCCGGGCGAATTCCGTCTTCTCTCGGACCGTGTCTTCGCCCGCCACACCGAGACGGCGTGCGCG
TGGCAGGAGAATGCCC
GTGAGCAGATTCTCCTGCTGCTTCCTGGCTACCGACTCACTCGATGGTTCAGTGAGCCAGTCGGCCATGGCGAGCAACTTCCAGACTGCCTTCAGCAAACTCTC
GCTCCTGGGCCATGACAAGAACAGCCTCCTGGACTGCAGCGAGCTCATC
GTGCGTAGTCGTATGCCCGTCACCTCGACGTTTGTTAACACGTCGATTAACAGGGCACGCCGCCGCCCGCC
ACGGCCAAGCAGGCTTTCTTCCCGCCGGGCAAGACGCACGACGATATCGAGCAGGGT
GTATGTAACGTCGAGCCAACTGTCTTGCCCATCTGATGACTCCTCCAGTGCGCAACGCAGCTG
TTCCCGACGACGCTGGTCACGATGGCGGGCCAGCCGACGAAGATTCCCGTCGT
GTGCGTGACTCTGCGATTCCCTCAGTGCGGTCTAATACTAATGCATTGAAAAGTCAAGTCCAGGACA
TCGCCTTCGGCAGGAAGAGGAAGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATCGCTGCGCCACTCGTCGCTCTTGGCCTCGCAGCCGCTGCCTATGCTGCGCCCGCTGCAACCTGCGCCGACGGCGTGCACACCGCAATAAACCCTCAGTGTTGCTTCTGGGCCAAT
GTCCGCGACAGATTCATCAACGAAATCTTCCTCAATGTCTGCAAGGAGAACGTGCACTCGCTCGTGCGGATCGCGTTCCACGACGCCATCGGCTTCTCTCTACACTCGAACAAGGGCGGA
GGAGCAGACGGGAGCATGATCCAATTCGGCGACGTTGAGCTTGCATACC
ATGCGAACGAGGGCATCGACTTCATCACGGCGTTCCTGCAACCCTTCGCTGACACCGTCGGAATCACCTAC
GGTGACGCCATCCAATTCGGTGCAGCAGTCGGTCTCTCGCTCTGCCCTGGTGCTCCGCGCATCCCCGCTTTCGTGGGCCGCCCGAATGCCACTCAGGCTGCCCCGGACAAGACT
GTGCCT
GAGCCCGATGACGA
CCCGACCACCATCTTCGCACGCATGGCCGATGCTGGCTTCACGCCCGTGGAGTTGGTACACCTTCTCGCGTCGCACAGCATTGCCGACCAGGCCGGCGTGGACCCG
GAGGACGTCGTCCTCGGCGCACCGTTCGACTCGACACCGTTCAGCTTCGACTCGCAGGTCTTCCTCGAGGTCATGCTGCGCGGTACCCTGTTCCCCGGCTCTGGTCCCAACCCTG
GTGAG
GAACTGAGCCCTCTTCCGGGCGAATTCCGTCTTCTCTCGGACCGTGTCTTCGCCCGCCACACCGAGACGGCGTGCGCGTGGCAGGAGAATGCCC
TGAGCCAGTCGGCCATGGCGAGCAAC
TTCCAGACTGCCTTCAGCAAACTCTCGCTCCTGGGCCATGACAAGAACAGCCTCCTGGACTGCAGCGAGCTCATC
GGCACGCCGCCGCCCGCCACGGCCAAGCAGGCTTTCTTCCCGCCG
GGCAAGACGCACGACGATATCGAGCAGGGT
TGCGCAACGCAGCTGTTCCCGACGACGCTGGTCACGATGGCGGGCCAGCCGACGAAGATTCCCGTCGTTCAAGTCCAGGACATCGCCTTC
GGCAGGAAGAGGAAGTGA

Retrieve as FASTA