Entry information : AdelCIIBA10 (GP10)
Entry ID 9709
Creation 2011-11-16 (Christophe Dunand)
Last sequence changes 2011-11-16 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2015-02-02 (Christophe Dunand)
Peroxidase information: AdelCIIBA10 (GP10)
Name (synonym) AdelCIIBA10 (GP10)
Class Other class II peroxidase type A    [Orthogroup: CIIBA002]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Auriculariaceae Auricularia
Organism Auricularia delicata    [TaxId: 160860 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AdelCIIBA10
start..stop
S start..stop
AdelCIIBA04 647 0 1..364 1..364
AdelCIIBA03 622 0 26..364 25..363
AdelCIIBA14 621 0 2..364 4..366
AdelCIIBA02 617 0 23..364 23..364
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 8980..9028 49 N° 2 9078..9133 56 N° 3 9185..9202 18 N° 4 9253..9278 26
N° 5 9334..9476 143 N° 6 9530..9572 43 N° 7 9623..9764 142 N° 8 9822..9849 28
N° 9 9896..9965 70 N° 10 10014..10156 143 N° 11 10205..10303 99 N° 12 10359..10459 101
N° 13 10508..10582 75 N° 14 10634..10701 68 N° 15 10753..10786 34  
join(8980..9028,9078..9133,9185..9202,9253..9278,9334..9476,9530..9572,9623..976 4,9822..9849,9896..9965,10014..10156,10205..10303,10359..10459,10508..10582,1063 4..10701,10753..10786)


exon

Literature and cross-references AdelCIIBA10 (GP10)
DNA ref. JGI genome:   scaffold_102 (8980..10786)
Protein sequence: AdelCIIBA10 (GP10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   364 (342)
PWM (Da):   %s   38496.07 (36460.9)  
PI (pH):   %s   4.39 (4.39) Peptide Signal:   %s   cut: 23 range:23-364
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MIAAPLFALALAALSIAAPAASVCPDGVHTAVNPCCFWANVRDRFINEIFLNVCKENVHSLVRIAFHDAIGFSLTSNKGGGADGSIIQFKDTELAHANEGIDFIVDFLQPFADAVGVTYGDAIQFGAAVGLSLCPGAPRIPAFVGRPNATQPAPDKVPEPDDDPTVIFARMQDAGFSPVDLVHLLASHSIADQAGVDPEPQVLGAPFDSTPFSFDSQIFLETMLRGTMFPGSGPNGEDQSPLPGEFRLLSDKVFARHNLTSCAWQANALSQSAMASNFQTVFSRLSLLGHNQNSLLDCSELATPPPATEKQAFFPPGKTHNDIEQGCATQAFPTTLSTQAGQPTMIPPVQVQDIAFGKK

Retrieve as FASTA  
Remarks Complete sequence from genomic (14 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATCGCTGCTCCTCTCTTTGCTCTCGCACTTGCGGCCCTCTCTATTGGTACGTCCCATAGACTTCCGATTTAAAAATGACTTACGACCGTTTAAAGCTGCTCCTGCGGCATCAGTGTG
CCCCGATGGTGTCCACACCGCCGTGAACCCCCAG
GTGAGCGCTTCGCTCCACGATCCGGGAACTTGCGCTGACAGCATGATCCAGTGTTGCTTCTGGGCCAACGTACGGATTACATACCT
CGATTCTGCACTCATATCTAATGTCGGCTGCAGGTCCGCGACAGGTTCATCAACGAGATGTGGGTGACGATTCCTGATCACGTGACACGCAACTAATAACGTGATCGTGTGAAGCTTCCT
GAACGTCTGCAAGGAGAACGTCCACTCGCTCGTCCGGATTGCGTTCCACGACGCCATCGGCTTCTCCTTGACCTCGAACAAGGGCGGCGGCGCCGACGGGAGCATCATTCAGTTCAAGGA
CACTGAGCTGGCGTTCC
GTGAGTCCTTCGGCAAATAGGTTCCCCGGCCAAACTGACCCTGGATCGTGCAGATGCGAACGAGGGTATCGACTTCATTGTGGATTTCCTCCAGCCGTGAATA
TTGCAGCTCCGGCCTCGCCTTCCATCTCGCTGATTGAGTTCAGATTTGCGGACGCAGTCGGTGTCACTTACGGCGACGCGATTCAGTTCGGCGCCGCAGTCGGCCTGTCGCTCTGCCCCG
GAGCGCCGAGAATACCGGCATTTGTGGGACGGCCAAACGCAACCCAGCCGGCTCCCGACAAGACG
GTACGGAGAACGTCGCTTACCTCAAGGACCAAGCTTGACATGCGAGTTTTGGTTT
AGGTCCCAGAGCCGGACGATGATCCCACCGGTGAGCGAATCCCACCAACACCGTGGCATGGGCTCACCTCCCGAAGTGATCTTTGCGCGCATGCAGGACGCAGGGTTCTCACCCGTCGAC
CTTGTGCATCTGCTTGCTTCTCACAG
GTAGAGTATAGGTTCTCTCCCCGTTCATGCCGCTCACACCCTCAACAGCATCGCGGACCAGGCCGGCGTTGACCCGGAGCCGCAAGTGCTCGGC
GCGCCGTTCGACTCCACTCCGTTCAGCTTCGACTCTCAGATCTTCCTCGAGACCATGCTGCGCGGTACCATGTTCCCCGGGTCCGGTCCTAACCCTG
GTGAGTTCGTCATACTTTCCAAT
GCTGTATGTACCAACGCACTGCTAGGTGAGGACCAAAGCCCGCTCCCAGGCGAATTCCGCCTCCTCTCGGACAAGGTGTTTGCGCGTCACAATCTAACCTCCTGCGCGTGGCAAGCGAAT
GCTC
GTACGTCTCCCCAGTCTCCCTGTCCCGGCGGAAACTTACAGAAGCGCGTGCACAGTGAGCCAATCGGCCATGGCTTCGAACTTCCAGACGGTGTTCTCCCGGCTGTCTCTGCTCGG
GCACAACCAGAACTCGCTCCTGGACTGCAGCGAGCTCATT
GTACGCTTCCATAGCGCCTCGAGCTTCTACGGCTGACCAGGCTGGTAGGCAACTCCGCCCCCGGCGACTGAGAAGCAGGC
GTTCTTCCCTCCAGGGAAGACGCACAATGACATCGAGCAGGGT
GTACGTTGTATCACGTGCGAGACGCTGCAGAGCCGCTGAATACCCGTTTAGTGCGCGACACAGGCATTCCCCACGAC
GCTCTCCACGCAAGCCGGACAGCCAACGATGATCCCTCCTGT
GTACGTCTCGGACCTCCCCAACGTCATGTGTTACATCTCACCTCTATGTAGACAAGTGCAGGACATCGCGTTTGGGAA
GAAGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATCGCTGCTCCTCTCTTTGCTCTCGCACTTGCGGCCCTCTCTATTGCTGCTCCTGCGGCATCAGTGTGCCCCGATGGTGTCCACACCGCCGTGAACCCCCAGTGTTGCTTCTGGGCC
AAC
GTCCGCGACAGGTTCATCAACGAGATCTTCCTGAACGTCTGCAAGGAGAACGTCCACTCGCTCGTCCGGATTGCGTTCCACGACGCCATCGGCTTCTCCTTGACCTCGAACAAGGGC
GGCGGCGCCGACGGGAGCATCATTCAGTTCAAGGACACTGAGCTGGCGTTCC
ATGCGAACGAGGGTATCGACTTCATTGTGGATTTCCTCCAGCCATTTGCGGACGCAGTCGGTGTCACT
TACGGCGACGCGATTCAGTTCGGCGCCGCAGTCGGCCTGTCGCTCTGCCCCGGAGCGCCGAGAATACCGGCATTTGTGGGACGGCCAAACGCAACCCAGCCGGCTCCCGACAAGACG
GTC
CCAGAGCCGGACGATGATCCCACCG
TGATCTTTGCGCGCATGCAGGACGCAGGGTTCTCACCCGTCGACCTTGTGCATCTGCTTGCTTCTCACAGCATCGCGGACCAGGCCGGCGTTGAC
CCGGAGCCGCAAGTGCTCGGCGCGCCGTTCGACTCCACTCCGTTCAGCTTCGACTCTCAGATCTTCCTCGAGACCATGCTGCGCGGTACCATGTTCCCCGGGTCCGGTCCTAACCCTG
GT
GAGGACCAAAGCCCGCTCCCAGGCGAATTCCGCCTCCTCTCGGACAAGGTGTTTGCGCGTCACAATCTAACCTCCTGCGCGTGGCAAGCGAATGCTC
TGAGCCAATCGGCCATGGCTTCG
AACTTCCAGACGGTGTTCTCCCGGCTGTCTCTGCTCGGGCACAACCAGAACTCGCTCCTGGACTGCAGCGAGCTCATT
GCAACTCCGCCCCCGGCGACTGAGAAGCAGGCGTTCTTCCCT
CCAGGGAAGACGCACAATGACATCGAGCAGGGT
TGCGCGACACAGGCATTCCCCACGACGCTCTCCACGCAAGCCGGACAGCCAACGATGATCCCTCCTGTACAAGTGCAGGACATCGCG
TTTGGGAAGAAGTAG

Retrieve as FASTA