Entry information : AdelCIIBA13 (MnP3-atypical)
Entry ID 9710
Creation 2011-11-16 (Christophe Dunand)
Last sequence changes 2011-11-23 (Christophe Dunand (Scipio))
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-02-02 (Christophe Dunand)
Peroxidase information: AdelCIIBA13 (MnP3-atypical)
Name (synonym) AdelCIIBA13 (MnP3-atypical)
Class Other class II peroxidase type A    [Orthogroup: CIIBA002]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Auriculariaceae Auricularia
Organism Auricularia delicata    [TaxId: 160860 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AdelCIIBA13
start..stop
S start..stop
AdelCIIBA12 481 4e-172 24..358 14..347
AdelCIIBA16 431 5e-152 29..361 25..355
AdelCIIBA15 427 1e-150 1..361 1..355
AdelCIIBA01 410 8e-144 29..361 17..347
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 193502..193562 61 N° 2 193395..193453 59 N° 3 193242..193347 106 N° 4 193111..193135 25
N° 5 192998..193053 56 N° 6 192867..192945 79 N° 7 192735..192810 76 N° 8 192653..192682 30
N° 9 192157..192594 438 N° 10 192030..192104 75 N° 11 191904..191971 68 N° 12 191842..191854 13
complement(join(191842..191854,191904..191971,192030..192104,192157..192594,1926 53..192682,192735..192810,192867..192945,192998..193053,193111..193135,193242..1 93347,193395..193453,193502..193562))


exon

Literature and cross-references AdelCIIBA13 (MnP3-atypical)
DNA ref. JGI genome:   scaffold_52 (193562..191842)
Protein sequence: AdelCIIBA13 (MnP3-atypical)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   361 (340)
PWM (Da):   %s   37943.35 (35767.2)  
PI (pH):   %s   5.07 (4.85) Peptide Signal:   %s   cut: 22 range:22-361
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFTALRAFVLASAMARLALALPDALRLCPNGKDRVKNLCCAWASIRDDLINDLYEGVCGEAAHSVIRIAFHDVIGFSVHGNRGGGADGSIIQFDDIELAPANAGIDEIAEDLRPFADAHGISYGDAIQFGSSVALSLCPGAPVVQTFVGRNATAPAPDGTVPEPFDPVTNILARMKDAGFSPAELIALLASHSVAAQDEIEPAIARAPFDSTPDAFDPQVYLEVLLKGDVLPGNLGPGKGEVLSPFEGEFRLESDFALARDPRTACAWQSFVNDHAAMAKKFATAMAKMGLLGQNPRKLIDCTEVIPQAKPAKAKTAIIPSGKTRKDIEASCRGTAFPALPTARGPPLTSVPPVPEQ

Retrieve as FASTA  
Remarks Complete sequence from genomic (12 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCACTGCTCTTCGCGCGTTCGTCCTCGCCTCGGCAATGGCACGCCTGGCACTCGGTCAGTGCACCGTCACCGTCGCTGTCCACGTCCCTGATCGTGTTGCAGCTCTGCCTGAT
GCTCTCAGACTTTGCCCCAACGGCAAGGACCGCGTCAAGAACCTTCAG
GTCTGTGACGCCCTATGCGTTGCGACTGAGCCTGACACCGGCCTCAGTGCTGCGCGTGGGCTAGCATCCGCG
ACGACCTCATCAACGACCTCTACGAAGGGGTCTGCGGTGAGGCGGCGCACTCGGTCATCCGCATTGCCTTCCACGATGTAA
GTCGCTTCCAGATCTTCGTTCGGGTCCTCGGTCAGGGCT
GACATTCGCGTTGCAGGCCAGTACGTAAATCACGTGTACCCCAGTGTTCTTCTCATACCGCGTGCAGTCGGCTTTAGTGTGCATGGGAACCGGTGTGTACTTTCTCTCGGCGACCCTGAC
TGGCAAGTAACCGCGATCCTCCCACGCAGCGGCGGTGGTGCTGATGGTTCTATCATTCAATTTGACGACATTGAACTCGCCTACCGTACGCGAGCTCATCTGGATACCCTCTGGCCACCG
TAATCACCCGTTTCCAGCTGCCAATGCCGGTATAGACGAGATTGCCGAGGACCTCCGTCCGTTCGCCGATGCTCATGGCATCTCTTACGGTGATGCGTAAGTATTAGGTAGTCGTATGTG
GGGATACCAGGTTGACCACCTACCCATATTAGGATCCAGTTTGGGTCGTCGGTCGCGCTCTCGCTCTGCCCCGGCGCCCCCGTAGTCCAGACCTTCGTTGGGCGCAAGGTACGTACCAAA
ATATTTGTCAACAATCTGACACTGGTTGACAATCATTCAGAACGCCACTGCCCCTGCGCCGGACGGCACCGTACGTGATATCGCATCCCTGTTTCACCGTACGGAGGCAGCTAACTCCGG
GCGCGCAGGTGCCGGAGCCGTTCGACCCTGTGACGAACATCCTCGCGCGCATGAAGGACGCGGGCTTCTCGCCCGCGGAGCTCATCGCGCTGCTCGCGTCGCACTCCGTCGCCGCGCAGG
ACGAAATCGAGCCTGCCATCGCGCGCGCGCCGTTCGACAGCACGCCGGACGCGTTCGACCCGCAGGTGTACCTCGAGGTGCTCCTCAAGGGCGACGTGCTGCCCGGCAACCTCGGCCCCG
GCAAAGGCGAGGTGCTCTCGCCGTTCGAGGGCGAGTTCCGCCTCGAGTCGGACTTCGCGCTCGCGCGCGACCCGCGCACGGCGTGCGCGTGGCAGTCGTTCGTTAATGACCATGCTGCGA
TGGCCAAGAAGTTTGCCACGGCCATGGCCAAGATGGGGCTTCTGGGACAGAATCCACGCAAGCTCATCGACTGCACGGAAGTCATT
GTAAGCATGCGTCTCTTCGTTACTGTGGCCATTA
CTCAAATCCGTTATGTAGCCTCAGGCCAAGCCTGCGAAGGCTAAGACTGCGATCATTCCTTCCGGAAAGACTCGCAAGGACATCGAGGCATCTGTAAGTCACATGGACCATCCTAATTTC
CCGGTTTCTGTTAGATTCTAACCGACCACAGTGCCGCGGCACCGCGTTCCCTGCCCTGCCCACTGCACGCGGCCCTCCGCTCACGTCGGTTCCTCCCGTGTACGTGAAACTTTGCGAGCA
GGTTGACCAAGCTCACCAGCAACTACAGTCCTGAGCAGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCACTGCTCTTCGCGCGTTCGTCCTCGCCTCGGCAATGGCACGCCTGGCACTCGCTCTGCCTGATGCTCTCAGACTTTGCCCCAACGGCAAGGACCGCGTCAAGAACCTTCAG
TGCTGCGCGTGGGCTAGCATCCGCGACGACCTCATCAACGACCTCTACGAAGGGGTCTGCGGTGAGGCGGCGCACTCGGTCATCCGCATTGCCTTCCACGATGTAATCGGCTTTAGTGTG
CATGGGAACCG
CGGCGGTGGTGCTGATGGTTCTATCATTCAATTTGACGACATTGAACTCGCCTACCCTGCCAATGCCGGTATAGACGAGATTGCCGAGGACCTCCGTCCGTTCGCCGAT
GCTCATGGCATCTCTTACGGTGATGC
GATCCAGTTTGGGTCGTCGGTCGCGCTCTCGCTCTGCCCCGGCGCCCCCGTAGTCCAGACCTTCGTTGGGCGCAAGAACGCCACTGCCCCTGCG
CCGGACGGCACC
GTGCCGGAGCCGTTCGACCCTGTGACGAACATCCTCGCGCGCATGAAGGACGCGGGCTTCTCGCCCGCGGAGCTCATCGCGCTGCTCGCGTCGCACTCCGTCGCCGCG
CAGGACGAAATCGAGCCTGCCATCGCGCGCGCGCCGTTCGACAGCACGCCGGACGCGTTCGACCCGCAGGTGTACCTCGAGGTGCTCCTCAAGGGCGACGTGCTGCCCGGCAACCTCGGC
CCCGGCAAAGGCGAGGTGCTCTCGCCGTTCGAGGGCGAGTTCCGCCTCGAGTCGGACTTCGCGCTCGCGCGCGACCCGCGCACGGCGTGCGCGTGGCAGTCGTTCGTTAATGACCATGCT
GCGATGGCCAAGAAGTTTGCCACGGCCATGGCCAAGATGGGGCTTCTGGGACAGAATCCACGCAAGCTCATCGACTGCACGGAAGTCATT
CCTCAGGCCAAGCCTGCGAAGGCTAAGACT
GCGATCATTCCTTCCGGAAAGACTCGCAAGGACATCGAGGCATCT
TGCCGCGGCACCGCGTTCCCTGCCCTGCCCACTGCACGCGGCCCTCCGCTCACGTCGGTTCCTCCCGTTCCTGAG
CAGTAG

Retrieve as FASTA