Entry information : AdelCIIBA09 (GP9)
Entry ID 9711
Creation 2011-11-16 (Christophe Dunand)
Last sequence changes 2016-06-29 (Catherine Mathe)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-06-29 (Catherine Mathe)
Peroxidase information: AdelCIIBA09 (GP9)
Name (synonym) AdelCIIBA09 (GP9)
Class Other class II peroxidase type A    [Orthogroup: CIIBA001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Auriculariaceae Auricularia
Organism Auricularia delicata    [TaxId: 160860 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AdelCIIBA09
start..stop
S start..stop
LquiCIIBB01 346 3e-118 16..372 8..364
PoVP04_PC9 332 5e-113 13..363 6..344
PoVP04_PC15 332 8e-113 13..372 6..353
SsteCIIBB01 330 7e-112 22..372 16..359
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 887655..887792 138 N° 2 887845..887888 44 N° 3 887938..887999 62 N° 4 888055..888106 52
N° 5 888158..888216 59 N° 6 888268..888563 296 N° 7 888624..888840 217 N° 8 888913..889085 173
N° 9 889142..889200 59 N° 10 889260..889290 31  
join(887655..887792,887845..887888,887938..887999,888055..888106,888158..888216, 888268..888563,888624..888840,888913..889085,889142..889200,889260..889290)


exon

Literature and cross-references AdelCIIBA09 (GP9)
DNA ref. JGI genome:   scaffold_2 (887655..889290)
Protein sequence: AdelCIIBA09 (GP9)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   377
PWM (Da):   %s   40750.47  
PI (pH):   %s   8.37
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVRRSSQSVRNWLNGLITAGVINIGERATRRPVKCPGNNHYAQKAQCCVWYDVLDDIQENLFDGGKCGAEAHESLRLSFHDPIGYSVTSNLLSFGRKNKAPGGADGSIIAFADIELEYAGNAGLADIADDQKNVADDHKVSYGDIIQFAGAVALANCPGSPRIQFLAGRPNATVPAPQSSLPSPFDSVPKILLRLADATFTPAEVVALMASHSLGGQKNVDKSKSGYTFDTTPDKLDSQFFLETLLKGTEKGRTAFGTAPAPVENQIRLQSDYALARHPLTSCTWQSYINNQKLMSTQFGKAMEKLAVLGQRKASLYDCSEVIPTPAAYNTPATYPAGKSSRDIEASASIQCAWYRFPKLSSDRPDRTSKTPWKGY*

Retrieve as FASTA  
Remarks Complete sequence from genomic (9 introns). Incorrect prediction from JGI
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGCGCCGCTCATCACAGTCCGTACGAAACTGGCTGAACGGGCTAATCACAGCCGGCGTAATCAACATCGGCGAGCGCGCCACCCGCAGGCCCGTCAAGTGCCCAGGCAACAACCAT
TACGCGCAGAAGGCGCAG
GTGCATTGTCGCACTACCCCTCTGGGATTGTCGCTGAGCGTTCCTATTCTAGTGCTGCGTGTGGTACGATGTGCTGGATGACATTCAAGAAAACCTGTAGGG
GCATGCATCTGAGGTGGCCACGGATCGACTGATCGTCGCGCAGCTTCGATGGTGGCAAATGCGGCGCTGAGGCCCATGAAAGCTTGCGCCTGTCATTCCACGATCGTACGCCGTCCCCGT
CTCCGCCATATGCGCATGCGTCGCTTACCCCGTCCATCAGCCATCGGCTATTCTGTAACGTCGAACCTCCTGAGCTTCGGACGGAAGAACAAGTGCGTGGTTCCACGAGGAGTCTTCGTT
CGCGATGCTGACTCTCTCTCAAGGGCTCCCGGTGGCGCTGACGGCTCGATCATCGCGTTCGCAGATATCGAGCTCGAGTACGGTGAGCCTGGCACGGCATAGCGTGTGTTTGTCCAATTC
ACCTCATGCACAGCGGGCAACGCTGGCCTCGCTGACATTGCCGATGATCAGAAGAATGTCGCGGACGACCACAAGGTCTCATACGGGGACATCATCCAGTTCGCCGGTGCGGTCGCGCTG
GCCAACTGCCCGGGGTCCCCAAGAATTCAGTTCCTTGCGGGACGGCCAAATGCCACGGTTCCTGCCCCCCAGAGCTCGCTGCCGTCACCCTTCGACTCTGTACCGAAGATCCTTCTGCGT
CTGGCAGACGCGACGTTCACACCTGCTGAGGTCGTAGCTCTGATGGCAAGCCATTCTCTGGGCGGCCAA
GTGCGTCCCTGCATTGTCCTCTTCCATCAGGCAGGAGATCTCACGCACGGG
TCTCTGCAGAAAAATGTAGACAAGAGCAAGAGCGGCTACACCTTTGACACGACTCCGGACAAGCTGGACTCTCAATTCTTCCTCGAGACGTTGCTGAAGGGCACTGAGAAGGGCCGCACG
GCATTTGGCACCGCACCGGCACCAGTCGAGAATCAGATTCGTCTGCAGAGCGACTACGCCCTCGCGCGCCACCCCCTCACCAGCTGCACGTGGCAGTCGTATATCA
GTGCGTACCTTACT
TTATTCTCTCATCCTGGATGGTTCCAAATCCTGATAAATCGTTTCATTGTGCGATCAGACAACCAGAAGCTCATGTCCACACAATTCGGGAAAGCGATGGAAAAACTCGCAGTCCTTGGC
CAGCGGAAGGCGTCGCTTTACGACTGTAGCGAAGTGATCCCTACACCGGCCGCATACAACACACCCGCGACGTATCCCGCGGGAAAGTCGTCCCGGGACATCGAAGCTTCC
GTGCGTTCC
GGCGTGAATCCTATGCTTATGCCACAGAACAGCCACTCACTCACCAGGCATCAATCCAGTGTGCTTGGTACCGTTTCCCTAAGCTTTCTTCGGACAGGCCCGATAGGTAAACCCGGCCTC
CGCGTGCTCATACAACGGATAGCTGACCACCCTTGATATGCACAGGACTTCGAAGACGCCCTGGAAGGGTTACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGCGCCGCTCATCACAGTCCGTACGAAACTGGCTGAACGGGCTAATCACAGCCGGCGTAATCAACATCGGCGAGCGCGCCACCCGCAGGCCCGTCAAGTGCCCAGGCAACAACCAT
TACGCGCAGAAGGCGCAG
TGCTGCGTGTGGTACGATGTGCTGGATGACATTCAAGAAAACCTCTTCGATGGTGGCAAATGCGGCGCTGAGGCCCATGAAAGCTTGCGCCTGTCATTCCAC
GATC
CCATCGGCTATTCTGTAACGTCGAACCTCCTGAGCTTCGGACGGAAGAACAAGGCTCCCGGTGGCGCTGACGGCTCGATCATCGCGTTCGCAGATATCGAGCTCGAGTACGCGGGC
AACGCTGGCCTCGCTGACATTGCCGATGATCAGAAGAATGTCGCGGACGACCACAAGGTCTCATACGGGGACATCATCCAGTTCGCCGGTGCGGTCGCGCTGGCCAACTGCCCGGGGTCC
CCAAGAATTCAGTTCCTTGCGGGACGGCCAAATGCCACGGTTCCTGCCCCCCAGAGCTCGCTGCCGTCACCCTTCGACTCTGTACCGAAGATCCTTCTGCGTCTGGCAGACGCGACGTTC
ACACCTGCTGAGGTCGTAGCTCTGATGGCAAGCCATTCTCTGGGCGGCCAA
AAAAATGTAGACAAGAGCAAGAGCGGCTACACCTTTGACACGACTCCGGACAAGCTGGACTCTCAATTC
TTCCTCGAGACGTTGCTGAAGGGCACTGAGAAGGGCCGCACGGCATTTGGCACCGCACCGGCACCAGTCGAGAATCAGATTCGTCTGCAGAGCGACTACGCCCTCGCGCGCCACCCCCTC
ACCAGCTGCACGTGGCAGTCGTATATCA
ACAACCAGAAGCTCATGTCCACACAATTCGGGAAAGCGATGGAAAAACTCGCAGTCCTTGGCCAGCGGAAGGCGTCGCTTTACGACTGTAGC
GAAGTGATCCCTACACCGGCCGCATACAACACACCCGCGACGTATCCCGCGGGAAAGTCGTCCCGGGACATCGAAGCTTCC
GCATCAATCCAGTGTGCTTGGTACCGTTTCCCTAAGCTT
TCTTCGGACAGGCCCGATAG
GACTTCGAAGACGCCCTGGAAGGGTTACTGA

Retrieve as FASTA