Entry information : AdelCIIBA08 (GP8)
Entry ID 9715
Creation 2011-11-17 (Christophe Dunand)
Last sequence changes 2011-11-17 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2015-02-02 (Christophe Dunand)
Peroxidase information: AdelCIIBA08 (GP8)
Name (synonym) AdelCIIBA08 (GP8)
Class Other class II peroxidase type A    [Orthogroup: CIIBA002]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Auriculariaceae Auricularia
Organism Auricularia delicata    [TaxId: 160860 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AdelCIIBA08
start..stop
S start..stop
AdelCIIBA07 645 0 1..363 1..363
AdelCIIBA05 637 0 1..362 1..362
AdelCIIBA03 614 0 25..363 25..363
AdelCIIBA06 612 0 1..363 1..366
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 299641..299742 102 N° 2 299571..299588 18 N° 3 299492..299517 26 N° 4 299296..299438 143
N° 5 299201..299243 43 N° 6 298977..299146 170 N° 7 298710..298922 213 N° 8 298554..298652 99
N° 9 298393..298493 101 N° 10 298256..298330 75 N° 11 298131..298198 68 N° 12 298045..298078 34
complement(join(298045..298078,298131..298198,298256..298330,298393..298493,2985 54..298652,298710..298922,298977..299146,299201..299243,299296..299438,299492..2 99517,299571..299588,299641..299742))


exon

Literature and cross-references AdelCIIBA08 (GP8)
DNA ref. JGI genome:   scaffold_39 (299742..298045)
Protein sequence: AdelCIIBA08 (GP8)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   363 (346)
PWM (Da):   %s   38516.29 (36968.4)  
PI (pH):   %s   4.51 (4.51) Peptide Signal:   %s   cut: 18 range:18-363
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLAAPLVALALSAIAAAAPAATCPDGVHSAVNPQCCFWANVRDRFINEIFLNVCRENVHSLVRIAFHDAIGFSLNSDKGGGADGSMIQFGDIELNPANEGINFITAFLQPFADTVGITYGDAIQFGAAVGLSLCPGAPKIPAFVGRPNATRPAPDKTVPEPQDDLKIFARMADAGFTPTELIHLLASHSIADQAGVDPEEVVLGAPFDSTPFEFDSQVFLEVMLKGTLFPGSGPNLGEDMSPLLGEFRLLSDRLFARDSRTSCAWQENALDQSKMASNFQAAFSKLSLLGHNKNDLLDCSELATAPPATQKQAHFPQGKTHNDIEQGCATQLFPTTLSTLAGQPTKIPVVQVQDIAFGKK

Retrieve as FASTA  
Remarks Complete sequence from genomic (11 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCGCCGCTCCGCTCGTCGCCCTCGCCCTCTCTGCCATCGCGGCAGCCGCACCCGCGGCGACTTGCCCGGACGGTGTCCATAGCGCGGTGAACCCCCAGGTAACGTCCATGGCCACC
CAGAACGCGCACCTTGCTGACTCGAGTTCGATAGTGCTGCTTCTGGGCCAACGTAAGACGGGTTTCTCTCTCCCTGTTCTGCGTCGAACTCATCGCCTGACACAGGTCCGCGATCGGTTC
ATCAACGAAAT
GTACGCACATATCGAGGTTGGACTGCAGCGTGGTCGCTCACGTCGCGTCCCAGCTTCCTGAACGTGTGCCGCGAGAACGTGCACTCGCTCGTCCGCATCGCGTTCCACG
ACGCGATCGGCTTCTCCCTCAACTCGGACAAGGGCGGCGGCGCGGACGGCTCGATGATCCAGTTCGGCGACATTGAGCTGAACTTCC
GTGCGTCTTCCCGACCGCGCCTTTCCCATGGCA
GGCTGACCGGGCGACGCAGCGGCGAACGAGGGCATCAACTTCATCACGGCCTTCCTACAGCCGTGCGTTGACACCCTAACTGCCTTATTGGGCCTCATATTGACGCCCTCTTTTAGATTC
GCAGACACCGTCGGCATCACGTACGGCGACGCGATCCAGTTCGGCGCCGCCGTCGGGCTCTCGTTGTGCCCCGGCGCGCCGAAGATCCCCGCGTTCGTCGGGCGCCCGAACGCGACGCGC
CCCGCGCCGGACAAGACCGTGCCCGAACCGCAGGACGACCTCACCA
GTACGCCCCTCCTTCCCTCCCTCCCTCTGATGCGGTGTCTGACTGAACGGACAGAGATCTTCGCGCGCATGGCG
GACGCGGGCTTCACGCCGACGGAGCTCATCCACCTGCTCGCGTCGCACTCGATCGCGGACCAGGCCGGCGTCGACCCCGAGGAGGTCGTGCTCGGCGCGCCGTTCGACTCGACGCCGTTC
GAGTTCGACTCGCAGGTCTTCCTCGAGGTCATGCTCAAGGGCACGCTCTTCCCCGGCTCCGGACCCAACCTTG
GTTCGCCCCTTCCCTTTTCCCCTTTCCCCATTTTCTCTTGTGCTGAT
ATCTGGGTAGGTGAGGACATGAGCCCGCTGCTCGGCGAGTTCCGTCTGCTCTCGGACCGCCTGTTCGCGCGCGACAGTCGCACATCGTGCGCGTGGCAAGAGAATGCTCGTGCGTGCTCT
CTCCCTTTCGGTGCCTCCGACGGATGAGACACTGATGTGCGAGCTGTAGTCGACCAGTCGAAGATGGCGTCCAACTTCCAGGCCGCGTTCTCGAAGCTGTCGCTGCTGGGCCACAACAAG
AACGATCTCCTCGACTGCAGCGAGCTGATC
GTGCGTCGTCTCCCCTCTTGCTCCTTTGTGCTGATTGTGCTCACATGTTTCTTTGTGCGCAGGCGACCGCGCCGCCCGCGACGCAGAAGC
AGGCGCACTTCCCGCAGGGAAAGACGCACAACGACATCGAGCAGGGC
GTGCGTGCTTTTCTCCTCTCCATCTGCCATGCTTCGCCGCTGACTCCCCTTGTGCAGTGCGCGACCCAGCTCT
TCCCGACGACCCTGTCCACGCTTGCGGGTCAGCCGACGAAGATCCCCGTCGT
GTGAGTGCTCTTCCCGCTTGTGCGTACAGCGAGTTTTGACTTGCCATCACAGCCAAGTGCAGGACATC
GCCTTCGGCAAGAAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCGCCGCTCCGCTCGTCGCCCTCGCCCTCTCTGCCATCGCGGCAGCCGCACCCGCGGCGACTTGCCCGGACGGTGTCCATAGCGCGGTGAACCCCCAGTGCTGCTTCTGGGCCAAC
GTCCGCGATCGGTTCATCAACGAAATCTTCCTGAACGTGTGCCGCGAGAACGTGCACTCGCTCGTCCGCATCGCGTTCCACGACGCGATCGGCTTCTCCCTCAACTCGGACAAGGGCGGC
GGCGCGGACGGCTCGATGATCCAGTTCGGCGACATTGAGCTGAACTTCC
CGGCGAACGAGGGCATCAACTTCATCACGGCCTTCCTACAGCCATTCGCAGACACCGTCGGCATCACGTAC
GGCGACGCGATCCAGTTCGGCGCCGCCGTCGGGCTCTCGTTGTGCCCCGGCGCGCCGAAGATCCCCGCGTTCGTCGGGCGCCCGAACGCGACGCGCCCCGCGCCGGACAAGACCGTGCCC
GAACCGCAGGACGACCTCACCA
AGATCTTCGCGCGCATGGCGGACGCGGGCTTCACGCCGACGGAGCTCATCCACCTGCTCGCGTCGCACTCGATCGCGGACCAGGCCGGCGTCGACCCC
GAGGAGGTCGTGCTCGGCGCGCCGTTCGACTCGACGCCGTTCGAGTTCGACTCGCAGGTCTTCCTCGAGGTCATGCTCAAGGGCACGCTCTTCCCCGGCTCCGGACCCAACCTTG
GTGAG
GACATGAGCCCGCTGCTCGGCGAGTTCCGTCTGCTCTCGGACCGCCTGTTCGCGCGCGACAGTCGCACATCGTGCGCGTGGCAAGAGAATGCTC
TCGACCAGTCGAAGATGGCGTCCAAC
TTCCAGGCCGCGTTCTCGAAGCTGTCGCTGCTGGGCCACAACAAGAACGATCTCCTCGACTGCAGCGAGCTGATC
GCGACCGCGCCGCCCGCGACGCAGAAGCAGGCGCACTTCCCGCAG
GGAAAGACGCACAACGACATCGAGCAGGGC
TGCGCGACCCAGCTCTTCCCGACGACCCTGTCCACGCTTGCGGGTCAGCCGACGAAGATCCCCGTCGTCCAAGTGCAGGACATCGCCTTC
GGCAAGAAGTAA

Retrieve as FASTA