Entry information : AdelCIIBA07 (GP7)
Entry ID 9718
Creation 2011-11-17 (Christophe Dunand)
Last sequence changes 2011-11-17 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2015-02-02 (Christophe Dunand)
Peroxidase information: AdelCIIBA07 (GP7)
Name (synonym) AdelCIIBA07 (GP7)
Class Other class II peroxidase type A    [Orthogroup: CIIBA002]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Auriculariaceae Auricularia
Organism Auricularia delicata    [TaxId: 160860 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AdelCIIBA07
start..stop
S start..stop
AdelCIIBA05 654 0 1..362 1..362
AdelCIIBA08 641 0 22..363 22..363
AdelCIIBA06 636 0 1..363 1..366
AdelCIIBA03 607 0 25..363 25..363
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 259016..259064 49 N° 2 258896..258966 71 N° 3 258815..258840 26 N° 4 258622..258764 143
N° 5 258531..258573 43 N° 6 258311..258480 170 N° 7 258043..258255 213 N° 8 257894..257992 99
N° 9 257740..257840 101 N° 10 257613..257687 75 N° 11 257495..257562 68 N° 12 257409..257442 34
complement(join(257409..257442,257495..257562,257613..257687,257740..257840,2578 94..257992,258043..258255,258311..258480,258531..258573,258622..258764,258815..2 58840,258896..258966,259016..259064))


exon

Literature and cross-references AdelCIIBA07 (GP7)
DNA ref. JGI genome:   scaffold_39 (259064..257409)
Protein sequence: AdelCIIBA07 (GP7)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   363 (346)
PWM (Da):   %s   38613.3 (36981.4)  
PI (pH):   %s   4.87 (4.87) Peptide Signal:   %s   cut: 18 range:18-363
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MFAASLITLALSAIASAAPAATCPDGKHTAVNQQCCFWAVRDRFINEIFLGVCHENVHSLVRIAFHDAIGFSLHSNKGGGADGSIIQFGNVELKPANEGIDFITAFLQPFADTVGIKYGDAIQFGAAVGLSLCPGAPKIPAFVGRKNATQAAPDKTVPEPQDDLNIFARMNDAGFSPTELIHLLASHSIADQAGVDPEEVVLGAPFDSTPFSFDSQVFLEVMLKGTLFPGSGPNLGEDMSPLPGEFRLLSDRLFARDSRTACAWQENALDQSKMSSNFQSAFSKLSLLGQNKNSLLDCSELATPPPATQRQAHFPQGKTHNDIEQACSTQLFPTTLSTLAGQPTKIPTVPVQDIAFGKK

Retrieve as FASTA  
Remarks Complete sequence from genomic (11 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTCGCCGCCTCGCTCATCACCCTCGCCCTCTCCGCCATTGCCTCAGGTACAAACACGATATTGGATCATGAGAGATGAGCTGACCGCCCGTTTAGCTGCGCCGGCTGCCACGTGCCC
TGACGGAAAGCACACTGCCGTCAACCAGCAGTGCTGCTTCTGGGCTAAT
GTAAGTTCGAGGAATGGTGCTCTCTATCCCCTCGCTGACCTCGGATTTATCATAGGTTCGCGATCGATTCA
TCAACGAGAT
GTGAGACGGCAGCTCGGAGTCTCACTCAGCGGCGTTCTGATATCTGGCAGCTTCCTGGGAGTATGCCACGAGAACGTGCACTCGCTCGTTCGTATCGCATTCCACGACGC
GATCGGCTTCTCTCTCCACTCGAACAAGGGCGGAGGCGCCGACGGCTCGATCATCCAGTTCGGGAACGTCGAACTCAAGTATC
GTGAGTCGTTCTCGCCGAGCTCAATAAAAATCTCACG
CACTCCCGCAGCTGCGAACGAGGGCATCGACTTCATCACTGCCTTCCTCCAACCGTGAGTGCACTTTGGCTGTATAAGCCGGCGTGAGCTTGACAGAGCTGCAGGTTTGCTGATACCGTT
GGAATCAAGTACGGCGACGCAATTCAATTCGGCGCTGCCGTCGGACTGTCGCTCTGCCCCGGCGCGCCGAAGATTCCGGCGTTCGTCGGCCGCAAGAACGCGACACAGGCTGCACCCGAC
AAGACGGTTCCCGAGCCGCAGGACGACCTCACCA
GTGCGTCCTCGCGCGGCAGCCGCCCCGATTTCTTTCTCATCGGATACCTCTCCAGATATCTTCGCGCGCATGAACGACGCCGGCTT
CAGCCCGACGGAGCTCATCCACCTGCTCGCGTCGCACAGCATCGCGGACCAGGCCGGCGTCGACCCCGAGGAGGTCGTGCTCGGCGCGCCGTTCGACTCGACGCCGTTCAGCTTCGACTC
GCAGGTCTTCCTCGAGGTCATGCTCAAGGGCACGCTGTTCCCCGGCTCCGGGCCCAACCTCG
GTACGCCTGCTCTCCCCGCACACCCGAAGAAGGCTGATGTCTATTTATAGGCGAAGAC
ATGAGCCCGCTACCGGGTGAATTCCGCTTGCTCTCCGACCGCCTCTTCGCGCGCGACAGCCGGACGGCGTGCGCGTGGCAGGAGAATGCCT
GTGCGTTTGTTCTCATTGCCGAACCGGGA
CGTGCGCTAACGCGCGAATGATAGTGGACCAGTCGAAGATGTCGTCTAACTTCCAGTCGGCGTTCAGCAAGCTCTCGCTGCTCGGCCAGAACAAGAACTCGCTCCTCGATTGCAGCGAGC
TGATC
GTGCGCGCTTCCCTCGAATTGATCTCGACTTCGGTTCTTATCCGCGTGCTAGGCTACCCCGCCGCCTGCGACGCAGAGGCAGGCGCACTTCCCGCAGGGAAAGACGCACAACGAC
ATCGAGCAGGCT
GTACGTTGTTCGCACAATTATCTCTCAGCGAATGCTCAGTCCCGTTTCAGTGCTCAACCCAGCTCTTCCCGACGACTCTCTCGACCTTGGCCGGACAGCCGACCAAGA
TCCCGACTGT
GTATGTAGAGTCTCATCCCCTTCCCACCCGCATTCTCAAAATATCTGTCCAGGCCCGTCCAGGACATTGCGTTCGGCAAGAAGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTCGCCGCCTCGCTCATCACCCTCGCCCTCTCCGCCATTGCCTCAGCTGCGCCGGCTGCCACGTGCCCTGACGGAAAGCACACTGCCGTCAACCAGCAGTGCTGCTTCTGGGCTAAT
GTTCGCGATCGATTCATCAACGAGATCTTCCTGGGAGTATGCCACGAGAACGTGCACTCGCTCGTTCGTATCGCATTCCACGACGCGATCGGCTTCTCTCTCCACTCGAACAAGGGCGGA
GGCGCCGACGGCTCGATCATCCAGTTCGGGAACGTCGAACTCAAGTATC
CTGCGAACGAGGGCATCGACTTCATCACTGCCTTCCTCCAACCGTTTGCTGATACCGTTGGAATCAAGTAC
GGCGACGCAATTCAATTCGGCGCTGCCGTCGGACTGTCGCTCTGCCCCGGCGCGCCGAAGATTCCGGCGTTCGTCGGCCGCAAGAACGCGACACAGGCTGCACCCGACAAGACGGTTCCC
GAGCCGCAGGACGACCTCACCA
ATATCTTCGCGCGCATGAACGACGCCGGCTTCAGCCCGACGGAGCTCATCCACCTGCTCGCGTCGCACAGCATCGCGGACCAGGCCGGCGTCGACCCC
GAGGAGGTCGTGCTCGGCGCGCCGTTCGACTCGACGCCGTTCAGCTTCGACTCGCAGGTCTTCCTCGAGGTCATGCTCAAGGGCACGCTGTTCCCCGGCTCCGGGCCCAACCTCG
GCGAA
GACATGAGCCCGCTACCGGGTGAATTCCGCTTGCTCTCCGACCGCCTCTTCGCGCGCGACAGCCGGACGGCGTGCGCGTGGCAGGAGAATGCCT
TGGACCAGTCGAAGATGTCGTCTAAC
TTCCAGTCGGCGTTCAGCAAGCTCTCGCTGCTCGGCCAGAACAAGAACTCGCTCCTCGATTGCAGCGAGCTGATC
GCTACCCCGCCGCCTGCGACGCAGAGGCAGGCGCACTTCCCGCAG
GGAAAGACGCACAACGACATCGAGCAGGCT
TGCTCAACCCAGCTCTTCCCGACGACTCTCTCGACCTTGGCCGGACAGCCGACCAAGATCCCGACTGTGCCCGTCCAGGACATTGCGTTC
GGCAAGAAGTAG

Retrieve as FASTA