Entry information : AdelCIIBA[P]18
Entry ID 9719
Creation 2011-11-17 (Christophe Dunand)
Last sequence changes 2011-12-06 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Nizar Fawal
Last annotation changes 2013-02-19 (Nizar Fawal)
Peroxidase information: AdelCIIBA[P]18
Name AdelCIIBA[P]18
Class Other class II peroxidase type A    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Auriculariaceae Auricularia
Organism Auricularia delicata    [TaxId: 160860 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AdelCIIBA[P]18
start..stop
S start..stop
AdelCIIBA06 166 3e-52 1..97 1..99
AdelCIIBA04 160 3e-50 1..97 1..97
AdelCIIBA10 154 1e-47 23..97 23..97
AdelCIIBA08 154 2e-47 24..97 23..96
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 502..606 105 N° 2 430..447 18 N° 3 353..378 26 N° 4 152..293 142
complement(join(152..293,353..378,430..447,502..606))


exon

Literature and cross-references AdelCIIBA[P]18
DNA ref. JGI genome:   scaffold_123 (606..46)
Protein sequence: AdelCIIBA[P]18
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   97 (80)
PWM (Da):   %s   10077.09 (8513.2)  
PI (pH):   %s   6.21 (6.21) Peptide Signal:   %s   cut: 18 range:18-97
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MIAAPLIALALAAVSSAAPAASLCPDGVHTAVNPQCCFWANVRDRFINEIFLNVCKENVHSLIRIAFHDAIGFSLNSNKGGGADGSIIKFGDTELN

Retrieve as FASTA  
Remarks Partial sequence from genomic (first 4 exon). Uncorrect prediction from JGI.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATCGCCGCTCCCCTCATCGCGCTTGCCCTCGCGGCGGTCTCTTCTGCCGCTCCGGCGGCATCCCTCTGCCCAGACGGAGTCCACACCGCGGTCAACCCTCAGGTTTGCATTCTTAAT
CGTCGCATGTCGCTCAGAAAGCTGACCTCTCTCTGACAGTGTTGCTTCTGGGCGAATGTTGGCCCTCTCACTACGTCCCACTTTACCCATCTGATTACGTGTTTCTAGGTCCGCGACAGA
TTCATCAACGAAAT
GTACGCACACGCACACCTCCCTCTTCGCGCGACCCGCGCTGACGGCGGGCGGGTGCCAGCTTCCTCAACGTGTGCAAGGAGAACGTGCACTCGCTCATCCGCATCG
CGTTCCACGACGCGATCGGCTTCTCGCTCAACTCGAACAAGGGCGGCGGCGCAGACGGCAGCATCATCAAGTTCGGCGACACCGAGCTCAACTTC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATCGCCGCTCCCCTCATCGCGCTTGCCCTCGCGGCGGTCTCTTCTGCCGCTCCGGCGGCATCCCTCTGCCCAGACGGAGTCCACACCGCGGTCAACCCTCAGTGTTGCTTCTGGGCG
AAT
GTCCGCGACAGATTCATCAACGAAATCTTCCTCAACGTGTGCAAGGAGAACGTGCACTCGCTCATCCGCATCGCGTTCCACGACGCGATCGGCTTCTCGCTCAACTCGAACAAGGGC
GGCGGCGCAGACGGCAGCATCATCAAGTTCGGCGACACCGAGCTCAACTTC

Retrieve as FASTA