Entry information : AdelCIIBB[P]18
Entry ID 9720
Creation 2011-11-17 (Christophe Dunand)
Last sequence changes 2011-11-17 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2012-04-06 (Catherine Mathe (Scipio))
Peroxidase information: AdelCIIBB[P]18
Name AdelCIIBB[P]18
Class Other class II peroxidase type B    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Auriculariaceae Auricularia
Organism Auricularia delicata    [TaxId: 160860 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AdelCIIBB[P]18
start..stop
S start..stop
AdelCIIBA03 400 3e-142 1..208 98..305
AdelCIIBA02 399 6e-142 1..208 99..306
AdelCIIBA04 383 2e-135 1..208 99..306
AdelCIIBA10 379 7e-134 1..208 99..306
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1072..1112 41 N° 2 1167..1308 142 N° 3 1359..1386 28 N° 4 1442..1654 213
N° 5 1709..1807 99 N° 6 1861..1994 134  
join(1072..1112,1167..1308,1359..1386,1442..1654,1709..1807,1861..1994)


exon

Literature and cross-references AdelCIIBB[P]18
DNA ref. JGI genome:   scaffold_153 (1072..1994)
Protein sequence: AdelCIIBB[P]18
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   218
PWM (Da):   %s   23279.64  
PI (pH):   %s   4.3
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ANEGIDFITAFLQPFADTVQITYGDAIQFGAAVGLSLCPDAPRIPAFVGRPNATQAAPDKVPEPDDDPTTIFARMKDAGFTPVELVHLLASHSVADQAGVDPEPQVLGAPFDSTPFSFDSQVFLEVMLRGTLFPGSGPNPGEEKSPLPGEFRLLSDRVFARHNETACAWQENALSQATMASNFQTAFSKLSLLGHDKNSLLDCSELIVHLRLSLIPE

Retrieve as FASTA  
Remarks Partial sequence from genomic (6 last exons). Uncorrect prediction from JGI (one exon not predicted).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCCAACGAGGGCATCGACTTTATCACCGCGTTCCTGCAGCCGTGCGTTTCGCAGGGCATTTCCTGCTTTAGAATGTTGCGCTGACGCCGGCGAAGGTTCGCGGACACCGTCCAGATCACG
TACGGCGACGCCATCCAGTTCGGCGCCGCCGTCGGGCTCTCGCTCTGCCCCGACGCGCCGCGCATCCCCGCGTTCGTCGGCCGCCCGAACGCGACGCAGGCCGCGCCCGACAAGACT
GTG
AGCACTCGCCCTCCTACAGACCCGCGTGTGGCTAACGCGCACATCAGGTGCCCGAGCCCGACGACGACCCAACGAGTGAGTGTACTACTGGCTGCGGGGGGCGAACGAACGCTAACGCGC
GCGCCCGCAGCGATCTTTGCGCGCATGAAGGACGCGGGCTTCACGCCCGTCGAGCTCGTGCACCTGCTCGCGTCGCACAGCGTCGCGGACCAGGCCGGCGTCGACCCCGAGCCGCAGGTG
CTCGGCGCGCCGTTCGACTCGACGCCGTTCAGCTTCGACTCGCAGGTCTTCCTCGAGGTCATGCTGCGCGGCACGCTCTTCCCGGGGTCCGGACCCAACCCTG
GTGCGCGCCGCCGTCCC
CCGCAGTGATTTCGCGCTGACGCGCGGCGACGCGAAGGCGAGGAGAAGAGCCCGCTGCCTGGTGAATTCCGCCTGCTGTCTGACCGCGTGTTCGCACGGCACAACGAGACGGCGTGCGCG
TGGCAGGAGAATGCTC
GTACGTTGCCCTCTCTCTCTTTCTCTCCTGTTTGCGTGCTGAGGAGAGGACAGTGAGCCAGGCGACGATGGCGTCCAACTTCCAGACGGCGTTCTCGAAGCTAT
CGCTCCTTGGGCACGACAAGAACTCGCTTCTCGACTGCAGCGAGCTCATCGTACATCTGCGCCTCTCACTCATACCGGAATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCCAACGAGGGCATCGACTTTATCACCGCGTTCCTGCAGCCGTTCGCGGACACCGTCCAGATCACGTACGGCGACGCCATCCAGTTCGGCGCCGCCGTCGGGCTCTCGCTCTGCCCCGAC
GCGCCGCGCATCCCCGCGTTCGTCGGCCGCCCGAACGCGACGCAGGCCGCGCCCGACAAGACT
GTGCCCGAGCCCGACGACGACCCAACGACGATCTTTGCGCGCATGAAGGACGCGGGC
TTCACGCCCGTCGAGCTCGTGCACCTGCTCGCGTCGCACAGCGTCGCGGACCAGGCCGGCGTCGACCCCGAGCCGCAGGTGCTCGGCGCGCCGTTCGACTCGACGCCGTTCAGCTTCGAC
TCGCAGGTCTTCCTCGAGGTCATGCTGCGCGGCACGCTCTTCCCGGGGTCCGGACCCAACCCTG
GCGAGGAGAAGAGCCCGCTGCCTGGTGAATTCCGCCTGCTGTCTGACCGCGTGTTC
GCACGGCACAACGAGACGGCGTGCGCGTGGCAGGAGAATGCTC
TGAGCCAGGCGACGATGGCGTCCAACTTCCAGACGGCGTTCTCGAAGCTATCGCTCCTTGGGCACGACAAGAACTCG
CTTCTCGACTGCAGCGAGCTCATCGTACATCTGCGCCTCTCACTCATACCGGAATGA

Retrieve as FASTA