Entry information : BaCIIBA
Entry ID 9722
Creation 2011-11-17 (Christophe Dunand)
Last sequence changes 2012-11-07 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-11-07 (Christophe Dunand)
Peroxidase information: BaCIIBA
Name BaCIIBA
Class Other class II peroxidase type A    [Orthogroup: CIIBA001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Meruliaceae Bjerkandera
Organism Bjerkandera adusta    [TaxId: 5331 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BaCIIBA
start..stop
S start..stop
CuniCIIBA01 498 1e-178 1..358 1..358
HanCIIBA 495 3e-177 1..361 1..361
CuniCIIBA04 491 1e-175 1..361 1..363
BaCIIBA04 488 3e-174 1..361 1..362
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 132036..132143 108 N° 2 132199..132242 44 N° 3 132298..132334 37 N° 4 132388..132413 26
N° 5 132468..132509 42 N° 6 132566..132579 14 N° 7 132630..132671 42 N° 8 132724..132761 38
N° 9 132818..132858 41 N° 10 132910..133150 241 N° 11 133206..133259 54 N° 12 133311..133455 145
N° 13 133515..133690 176 N° 14 133749..133813 65 N° 15 133869..133881 13  
join(132036..132143,132199..132242,132298..132334,132388..132413,132468..132509, 132566..132579,132630..132671,132724..132761,132818..132858,132910..133150,13320 6..133259,133311..133455,133515..133690,133749..133813,133869..133881)


exon

Literature and cross-references BaCIIBA
DNA ref. JGI genome:   scaffold_43 (132036..133881)
Protein sequence: BaCIIBA
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   361
PWM (Da):   %s   38183.06  
PI (pH):   %s   5.54
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKIALALAALATAVIAVPSRKVTCSPGRVVNDATCCQWFDVLDDIQKNLFDNGECGEEAHSLRLTFHDAIGFSLSAQRQGKFLGGGDGSIMAFADIETNYHASLGLDEIVGEKPFALKHNVSFGDFIQFAGAVAVSNCNGGPRLQFLAGRSNDSRLTPDGTIPEPFDSADKIFARMGDAGFSPAEVVALLASHSVAAQDHVDPIVGSPFDSTPSTFDGQFFLDVMLKGTLFPGNGSHPGEVMSPIPGEFRLQSDFVVSRDQRSACAWQTLITRHDLMVSQFESAMAKMATLGQNIHRLADCSDVIPVPKRLSTPNAVIPAGKTKKDIQPCRATPFPALPTASGPAISVAPVPPS

Retrieve as FASTA  
Remarks Complete sequence from genomic (13 introns). Probable uncorrect prediction (need to be fix)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCAAGATCGCTCTCGCACTCGCTGCTCTCGCCACTGCAGTCATCGCCGTGCCCTCTCGCAAGGTGACATGCAGCCCCGGTCGTGTCGTCAACGACGCAACTGTGAGTCTCTGG
TCAATGTTCATCTTGTTCAGAACTGACACTTCCCCGGTGACAGTGTTGCCAGTGGTTTGATGTACTCGATGACATCCAGAAGAACCTGTGAGTCTACGCTGTTTGCTCTGCTGCCCGTAC
TCTTCTCATGATAACACCATAGGTTCGATAACGGGGAATGTGGCGAGGAGGCCCATGAGGTATACGACAATGATCATACTTTCCAATTCTCAAATGCTCACCGACTCTCTAGTCGCTCCG
CTTGACTTTCCACGACGC
GTAAGTCGCCTTGGCTGAAATGTGCCTGAATTTGGTCGGCTAACAATGATACAGTATTGGGTTCAGTCTGTCGGCTCAGCGACAGGGGAAGTTCCTGTGGGT
GCTATTCATTTCATATGTTATTACCTCGTGGCTGACCGGCGTCATTATAGCGGTGGTGGCGCTGGCAAGTCTTAATAACCGCATTCCGAACTATCAACCCTGACATATCTCCAGATGGTT
CCATCATGGCCTTTGCCGACATCGAGACCAACTATC
GTGAGCCTTCGAACAGTCTGGTGCGAACGAGATCGTTAAAGTCTTCGATTAGATGCTAGCTTGGGCTTGGACGAGATTGTTGGG
GAACAG
GTGAGCTCGCGTGGAATTTCTTAAACGCGCTGATAATTGACATGGCATTTTTTTAGAAACCCTTCGCGTTGAAGCACAACGTTTCCTTCGGTGACTTGTACGTTTCGCACCGCA
CTTCACGCCTCTACACCTGCTCACACGACTGCAGCATCCAATTCGCCGGTGCCGTCGCAGTCTCCAACTGCAACGGAGGCCCTCGCCTTCAGTTCCTCGCCGGTCGGTCCAACGACTCTC
GCCTGACTCCCGATGGTACCATTCCGGAGCCGTTTGACTCCGCCGACAAGATCTTCGCTCGCATGGGTGATGCCGGGTTCTCCCCCGCCGAGGTCGTCGCTTTGCTCGCGTCGCACTCTG
TTGCCGCTCAGGACCACGTCGACCCTATCGTCCAC
GTTCGTTTTCTGCACTTGAATGTAATTAATTATCCAGGCTGACCTTCGTTCCTAGGGCTCGCCCTTCGACTCCACTCCAAGCACC
TTCGATGGCCAGTTCTTCCTCGAT
GTACGCAACGGACAGTTCTATCATCTGCATGCATCGCTCACCTCCCTTCAGGTCATGCTTAAGGGCACTCTCTTCCCCGGAAACGGCTCCCACCCT
GGCGAGGTTATGTCTCCCATCCCCGGTGAATTCCGCCTCCAGTCCGACTTTGTGGTCTCTCGCGACCAGCGTTCTGCCTGTGCTTGGCAGACCCTCATCA
GTACGCATCATCCCATAATG
CCCCAGGTTGTTTTTGTTGACAGCTCATGATTTCTTTAGCTCGCCACGACCTCATGGTCTCGCAGTTCGAGAGCGCGATGGCTAAGATGGCCACCCTAGGACAGAACATCCACCGCCTGG
CTGACTGTTCGGACGTCATCCCGGTCCCCAAGCGTCTCTCTACTCCCAACGCGGTCATCCCCGCCGGAAAGACGAAGAAGGACATCCAGCCTGCT
GTACGTCGTTTTCTCTCTTCTTCTC
GACCTTTCTACTCACCATCGACTCGCCTAATAGTGCCGTGCCACTCCTTTCCCCGCTCTGCCTACTGCCTCTGGCCCTGCTATCTCTGTTGCCCCTGTGTAAGTTCCAGATACCACCTTG
TGCTCAGGACAAGCCAGCTGACATCCTATGTAGCCCTCCTTCCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCAAGATCGCTCTCGCACTCGCTGCTCTCGCCACTGCAGTCATCGCCGTGCCCTCTCGCAAGGTGACATGCAGCCCCGGTCGTGTCGTCAACGACGCAACTTGTTGCCAGTGG
TTTGATGTACTCGATGACATCCAGAAGAACCT
GTTCGATAACGGGGAATGTGGCGAGGAGGCCCATGAGTCGCTCCGCTTGACTTTCCACGACGCTATTGGGTTCAGTCTGTCGGCTCAG
CGACAGGGGAAGTTCCT
CGGTGGTGGCGCTGATGGTTCCATCATGGCCTTTGCCGACATCGAGACCAACTATCATGCTAGCTTGGGCTTGGACGAGATTGTTGGGGAACAGAAACCCTTC
GCGTTGAAGCACAACGTTTCCTTCGGTGACTT
CATCCAATTCGCCGGTGCCGTCGCAGTCTCCAACTGCAACGGAGGCCCTCGCCTTCAGTTCCTCGCCGGTCGGTCCAACGACTCTCGC
CTGACTCCCGATGGTACCATTCCGGAGCCGTTTGACTCCGCCGACAAGATCTTCGCTCGCATGGGTGATGCCGGGTTCTCCCCCGCCGAGGTCGTCGCTTTGCTCGCGTCGCACTCTGTT
GCCGCTCAGGACCACGTCGACCCTATCGTCCAC
GGCTCGCCCTTCGACTCCACTCCAAGCACCTTCGATGGCCAGTTCTTCCTCGATGTCATGCTTAAGGGCACTCTCTTCCCCGGAAAC
GGCTCCCACCCTGGCGAGGTTATGTCTCCCATCCCCGGTGAATTCCGCCTCCAGTCCGACTTTGTGGTCTCTCGCGACCAGCGTTCTGCCTGTGCTTGGCAGACCCTCATCA
CTCGCCAC
GACCTCATGGTCTCGCAGTTCGAGAGCGCGATGGCTAAGATGGCCACCCTAGGACAGAACATCCACCGCCTGGCTGACTGTTCGGACGTCATCCCGGTCCCCAAGCGTCTCTCTACTCCC
AACGCGGTCATCCCCGCCGGAAAGACGAAGAAGGACATCCAGCCTGCT
TGCCGTGCCACTCCTTTCCCCGCTCTGCCTACTGCCTCTGGCCCTGCTATCTCTGTTGCCCCTGTCCCTCCT
TCCTAA

Retrieve as FASTA