Entry information : BaCIIBB05(GP1)
Entry ID 9734
Creation 2011-11-17 (Christophe Dunand)
Last sequence changes 2011-11-17 (Christophe Dunand)
Sequence status complete
Reviewer Catherine
Last annotation changes 2019-03-20 (Catherine )
Peroxidase information: BaCIIBB05(GP1)
Name BaCIIBB05(GP1)
Class Other class II peroxidase type B     [Orthogroup: CIIBB001]*
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Meruliaceae Bjerkandera
Organism Bjerkandera adusta    [TaxId: 5331 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BaCIIBB05
start..stop
S start..stop
BaCIIBB03 478 2e-170 1..364 1..364
PcriCIIBB07 469 3e-167 1..364 1..359
HanCIIBB07 466 9e-166 6..364 3..361
TvCIIBB03 464 3e-165 1..361 1..361
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 462608..462668 61 N° 2 462720..462870 151 N° 3 462921..462940 20 N° 4 462990..463161 172
N° 5 463212..463279 68 N° 6 463333..463462 130 N° 7 463519..463760 242 N° 8 463819..464059 241
N° 9 464113..464122 10  
join(462608..462668,462720..462870,462921..462940,462990..463161,463212..463279, 463333..463462,463519..463760,463819..464059,464113..464122)


exon

Literature and cross-references BaCIIBB05(GP1)
DNA ref. JGI genome:   scaffold_25 (462608..464122)
Cluster/Prediction ref. JGI gene:   173495
Protein sequence: BaCIIBB05(GP1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   364 (343)
PWM (Da):   %s   37613.39 (35428.2)  
PI (pH):   %s   4.06 (3.97) Peptide Signal:   %s   cut: 22 range:22-364
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVFYRLSSLLVSVAAIHAVAGALTRRVACPDGVNTATNAACCPLYAVRDDMQANLYDGGACNAEVHESLRLTFHDAGYSPALAAAGSFAGGGADGSILTFSDVEAAFFANAGLDEMIELQKPYITKYNMTPGDVVQFAGAVGLSNCPGAPQLEFLGRTAATAASPTGLIPAPFDTVDAIIERFADVDFSVDEIVALLASHSVAAASHIDTTVPESPLDSTPGVFDTQFFVETSLNGTMYPGTSGNIGEALSAIAGELRLLSDHELARDSRTACEWQSYNNQSKIQSAFRAAMARMAVIGQDSSTMIDCTEVIPTASSFTSAAFIPAGLTYADIEQSCDSTPFPTLSVVAGAATSVAAVAKS

Retrieve as FASTA  
Remarks Complete sequence from genomic (8 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGTTCTACAGACTCTCCTCCCTCCTTGTGTCTGTTGCTGCTATCCACGCCGTAGCCGGTACGCCACATACTGGCTCCCCCTCCCGATCCACGCTGACCAGCTTGCTAGGTGCTCTG
ACGCGCCGTGTCGCATGCCCGGATGGCGTGAACACCGCGACCAACGCGGCGTGCTGCCCTTTGTACGCCGTCCGAGATGACATGCAGGCCAACCTGTACGATGGTGGCGCGTGCAACGCC
GAGGTGCATGAGTCCCTCCGTCT
GTGAGTACCCAGCTTGCTTTCGCCGTCGCACAAAGCTCATCTAGTGCCAGCACATTCCACGACGCTATTGGTACGTCTTGCCTAGATTCCCTACAAC
GGTGTCTTACGATATTCTCCAGGCTACTCCCCAGCCCTCGCCGCCGCCGGCTCATTCGCAGGTGGAGGAGCTGACGGCTCCATCCTTACCTTCAGCGATGTTGAAGCAGCCTTCTTTGCC
AACGCGGGTCTCGACGAGATGATCGAGCTCCAGAAGCCATACATCACCAAGTACAACATGACTCCCGGCGATGT
GTACGTACCAAGAACTCCCAGGGCGTCATTATACTGAAGCGTCTCT
ATAGCGTTCAATTTGCTGGTGCCGTCGGTCTCAGTAACTGCCCAGGTGCCCCGCAGTTGGAGTTCCTTCTCGGTACGTCACGCAATAAATCAGACTGCGAAAGCCACGTTCTGATTATCG
TCCAGGCCGTACTGCCGCTACGGCCGCGTCGCCCACAGGCCTCATTCCCGCACCTTTTGACACGGTTGACGCGATCATTGAGCGCTTTGCCGACGTCGACTTCAGCGTTGACGAGATTGT
AGCGCTGTTGGCATC
GTAAGCACGCCCCTTTTGCTTGGCGAGCATCGTGATTAACAACATTCCACTGGCAGGCACTCGGTTGCCGCTGCAAGCCACATCGACACCACCGTTCCTGAGTCG
CCGCTCGACTCTACCCCGGGCGTATTCGACACCCAGTTCTTTGTCGAGACCTCGCTCAACGGCACCATGTACCCCGGTACCTCTGGAAACATCGGCGAGGCCCTGTCAGCGATTGCGGGA
GAGCTTCGCCTGCTCTCGGACCATGAGCTCGCGCGTGACTCGCGCACTGCCTGCGAGTGGCAGTCCTACGTCA
GTACGTACCCTCTCCTTCGGCTCCGTTGACGGATTCCATTTATACTT
TACGTGTGCAGACAACCAGTCCAAGATCCAGAGCGCGTTCCGTGCTGCTATGGCGAGGATGGCCGTCATCGGCCAGGACTCCTCGACCATGATTGACTGCACCGAAGTCATCCCCACCGC
ATCGTCCTTCACCTCCGCCGCGTTCATCCCCGCCGGTCTCACCTACGCTGACATCGAACAGTCGTGCGACTCCACTCCCTTCCCCACCCTTTCTGTCGTTGCCGGCGCGGCCACGTCCGT
CGCTGCCGTTGC
GTGAGTTGTTTCGGTTTCTCTCGAATTGCACATAGTACTGACAAAATATTTAGAAAATCATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGTTCTACAGACTCTCCTCCCTCCTTGTGTCTGTTGCTGCTATCCACGCCGTAGCCGGTGCTCTGACGCGCCGTGTCGCATGCCCGGATGGCGTGAACACCGCGACCAACGCGGCG
TGCTGCCCTTTGTACGCCGTCCGAGATGACATGCAGGCCAACCTGTACGATGGTGGCGCGTGCAACGCCGAGGTGCATGAGTCCCTCCGTCT
CACATTCCACGACGCTATTGGCTACTCC
CCAGCCCTCGCCGCCGCCGGCTCATTCGCAGGTGGAGGAGCTGACGGCTCCATCCTTACCTTCAGCGATGTTGAAGCAGCCTTCTTTGCCAACGCGGGTCTCGACGAGATGATCGAGCTC
CAGAAGCCATACATCACCAAGTACAACATGACTCCCGGCGATGT
CGTTCAATTTGCTGGTGCCGTCGGTCTCAGTAACTGCCCAGGTGCCCCGCAGTTGGAGTTCCTTCTCGGCCGTACT
GCCGCTACGGCCGCGTCGCCCACAGGCCTCATTCCCGCACCTTTTGACACGGTTGACGCGATCATTGAGCGCTTTGCCGACGTCGACTTCAGCGTTGACGAGATTGTAGCGCTGTTGGCA
TC
GCACTCGGTTGCCGCTGCAAGCCACATCGACACCACCGTTCCTGAGTCGCCGCTCGACTCTACCCCGGGCGTATTCGACACCCAGTTCTTTGTCGAGACCTCGCTCAACGGCACCATG
TACCCCGGTACCTCTGGAAACATCGGCGAGGCCCTGTCAGCGATTGCGGGAGAGCTTCGCCTGCTCTCGGACCATGAGCTCGCGCGTGACTCGCGCACTGCCTGCGAGTGGCAGTCCTAC
GTCA
ACAACCAGTCCAAGATCCAGAGCGCGTTCCGTGCTGCTATGGCGAGGATGGCCGTCATCGGCCAGGACTCCTCGACCATGATTGACTGCACCGAAGTCATCCCCACCGCATCGTCC
TTCACCTCCGCCGCGTTCATCCCCGCCGGTCTCACCTACGCTGACATCGAACAGTCGTGCGACTCCACTCCCTTCCCCACCCTTTCTGTCGTTGCCGGCGCGGCCACGTCCGTCGCTGCC
GTTGC
AAAATCATAA

Retrieve as FASTA