Entry information : BaCIIBB07(VP1)
Entry ID 9737
Creation 2011-11-17 (Christophe Dunand)
Last sequence changes 2012-03-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2019-03-20 (Catherine )
Peroxidase information: BaCIIBB07(VP1)
Name BaCIIBB07(VP1)
Class Other class II peroxidase type B    [Orthogroup: CIIBB001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Meruliaceae Bjerkandera
Organism Bjerkandera adusta    [TaxId: 5331 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BaCIIBB07
start..stop
S start..stop
BaCIIBB07_UAMH8258 738 0 1..366 1..366
BspCIIBB 705 0 1..366 1..367
BspCIIBB_other 680 0 29..366 1..338
BaCIIBB08 588 0 1..366 1..366
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 370006..370066 61 N° 2 369796..369946 151 N° 3 369687..369743 57 N° 4 369497..369631 135
N° 5 369362..369441 80 N° 6 369271..369312 42 N° 7 369138..369216 79 N° 8 368954..369079 126
N° 9 368780..368895 116 N° 10 368553..368728 176 N° 11 368436..368500 65 N° 12 368369..368381 13
complement(join(368369..368381,368436..368500,368553..368728,368780..368895,3689 54..369079,369138..369216,369271..369312,369362..369441,369497..369631,369687..3 69743,369796..369946,370006..370066))


exon

Literature and cross-references BaCIIBB07(VP1)
DNA ref. JGI genome:   scaffold_24 (370066..368369)
Cluster/Prediction ref. JGI gene:   43095
Protein sequence: BaCIIBB07(VP1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   366
PWM (Da):   %s   38299.81  
PI (pH):   %s   4.19
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKQLAAALSIALALPFSQAAITRRVACPDGVNTATNAACCALFAVRDDIQQNLFDGGECGEEVHESLRLTFHDAIGISPSIAATGKFGGGGADGSIMIFDDIEPNFHANNGVDEIINAQKPFVAKHNMTAGDFIQFAGAVGVSNCPGAPQLSFFLGRPATQPAPDGLVPEPFDSVTDILNRFADAGGFTTQEVVWLLASHSIAAADHVDPTIPGSPFDSTPEIFDTQFFVETLLKGTLFPGTSGNQGEVESPLAGEIRLQSDADFARDSRTACEWQSFNNQPRMQVLFKAAMQKLSILGHDLTQMIDCSDVIPVPPSTAVRGSHLPAGNTLDDIEQCASTPFPTLTADPGPATSVAPVPPS

Retrieve as FASTA  
Remarks Complete sequence from genomic (11 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAGCAACTCGCTGCTGCTCTTTCCATCGCCCTTGCACTCCCCTTCTCGCAAGGTTCGTATCTGTTGCTGCAGACCGTATTCTCCTCGATGCTCACCTTTTTCCATCCGTAG

CTGCGATCACCAGACGTGTGGCTTGCCCAGATGGCGTGAACACCGCAACCAACGCAGCCTGCTGTGCTTTGTTCGCCGTTCGTGATGACATCCAACAGAACTTGTTCGACGGCGGCGAGT
GCGGCGAAGAAGTGCACGAGTCACTTCGACT
GTATGGATTTTGTACCCTCGTTGTGAATTTTGCGCTCATTCTCTACCCTTAGTACCTTCCACGATGCTATCGGCATATCTCCAAGCATT
GCCGCCACTGGCAAATTCGG
GTACATATTGTGACTCTATTTGTATAATCGTCCCGACTAACGACCTTTTACTTAGTGGCGGAGGTGCCGACGGGTCTATCATGATCTTCGACGACATCGA
GCCCAATTTCCACGCCAACAACGGTGTCGACGAGATTATCAACGCGCAGAAGCCCTTCGTGGCCAAGCACAACATGACAGCAGGTGACTT
GTGAGTTGCTGTTCACCTCCTTCATGATAT
TACGTTCGCTGAATCAAACAAACAGTATTCAATTTGCAGGTGCCGTTGGCGTGAGTAACTGCCCTGGTGCCCCTCAACTGAGCTTCTTCCTCGGGCGCCCTGCAGGTACGGAATTTGCAA
CGATTGGATGTTCTTGTTCTCACCCTGCTTGTAGCGACGCAGCCCGCGCCTGACGGGCTTGTTCCGGAGCCCTTCGGTCAGCCCAATTATTATCCCGAATCCTTGGACTCGGACTGATGA
TGTTTATCAGACTCGGTCACCGACATCCTCAATCGCTTTGCCGATGCTGGCGGCTTCACAACCCAAGAAGTCGTTTGGCTCCTTGCTTCGTAAGTACTACTCTGGGCTCACTAAGTTTCT
GGTCCTAATTGATCATCATGTCCATAGTCATTCCATTGCTGCTGCTGACCACGTCGACCCGACGATCCCTGGATCACCCTTCGATTCTACTCCCGAAATTTTCGACACACAGTTCTTCGT
TGAGACGTTGTTGAAGGGCACGTTGTTCCCAGG
GTAAACCTCACAACCATACGTTCAATCATGAAAGATGCTAATTTTAATTATGATCTAGTACGAGCGGCAACCAGGGCGAAGTCGAGT
CTCCACTCGCCGGCGAAATTCGTCTCCAGTCAGATGCGGACTTCGCACGTGACTCGAGGACTGCTTGCGAGTGGCAGTCTTTCGTCA
GTGAGTACTTTCTAATCAAAGAAAAAGCAGATA
CTTATACGTTTATTTTAGACAACCAGCCCAGGATGCAAGTTCTGTTCAAGGCGGCTATGCAGAAGCTGTCTATCTTGGGCCACGATCTCACTCAGATGATTGACTGCTCCGACGTAATCC
CTGTACCTCCGAGCACAGCGGTCCGTGGATCGCATCTTCCTGCAGGCAACACACTGGACGACATTGAACAGGCT
GTGAGTACTATTCCTCAAATTCTCATAGGTGACAGCCTAACGTAAG
ACGTAGTGCGCCTCAACGCCATTCCCCACACTCACCGCCGACCCTGGTCCGGCCACCTCCGTTGCCCCTGTGTAAGTCTCAGCAATACGATATGGATGAGCGCCCCCATCTGACACCCCT
GATAGCCCGCCTTCGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAGCAACTCGCTGCTGCTCTTTCCATCGCCCTTGCACTCCCCTTCTCGCAAGCTGCGATCACCAGACGTGTGGCTTGCCCAGATGGCGTGAACACCGCAACCAACGCAGCC
TGCTGTGCTTTGTTCGCCGTTCGTGATGACATCCAACAGAACTTGTTCGACGGCGGCGAGTGCGGCGAAGAAGTGCACGAGTCACTTCGACT
TACCTTCCACGATGCTATCGGCATATCT
CCAAGCATTGCCGCCACTGGCAAATTCGG
TGGCGGAGGTGCCGACGGGTCTATCATGATCTTCGACGACATCGAGCCCAATTTCCACGCCAACAACGGTGTCGACGAGATTATCAACGCG
CAGAAGCCCTTCGTGGCCAAGCACAACATGACAGCAGGTGACTT
TATTCAATTTGCAGGTGCCGTTGGCGTGAGTAACTGCCCTGGTGCCCCTCAACTGAGCTTCTTCCTCGGGCGCCCT
GCAG
CGACGCAGCCCGCGCCTGACGGGCTTGTTCCGGAGCCCTTCGACTCGGTCACCGACATCCTCAATCGCTTTGCCGATGCTGGCGGCTTCACAACCCAAGAAGTCGTTTGGCTCCTT
GCTTC
TCATTCCATTGCTGCTGCTGACCACGTCGACCCGACGATCCCTGGATCACCCTTCGATTCTACTCCCGAAATTTTCGACACACAGTTCTTCGTTGAGACGTTGTTGAAGGGCACG
TTGTTCCCAGG
TACGAGCGGCAACCAGGGCGAAGTCGAGTCTCCACTCGCCGGCGAAATTCGTCTCCAGTCAGATGCGGACTTCGCACGTGACTCGAGGACTGCTTGCGAGTGGCAGTCT
TTCGTCA
ACAACCAGCCCAGGATGCAAGTTCTGTTCAAGGCGGCTATGCAGAAGCTGTCTATCTTGGGCCACGATCTCACTCAGATGATTGACTGCTCCGACGTAATCCCTGTACCTCCG
AGCACAGCGGTCCGTGGATCGCATCTTCCTGCAGGCAACACACTGGACGACATTGAACAGGCT
TGCGCCTCAACGCCATTCCCCACACTCACCGCCGACCCTGGTCCGGCCACCTCCGTT
GCCCCTGT
CCCGCCTTCGTAA

Retrieve as FASTA