Entry information : BaCIIBB08
Entry ID 9739
Creation 2011-11-17 (Christophe Dunand)
Last sequence changes 2011-11-17 (Christophe Dunand)
Sequence status complete
Reviewer Nizar Fawal
Last annotation changes 2012-10-29 (Nizar Fawal)
Peroxidase information: BaCIIBB08
Name BaCIIBB08
Class Other class II peroxidase type B    [Orthogroup: CIIBB001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Meruliaceae Bjerkandera
Organism Bjerkandera adusta    [TaxId: 5331 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BaCIIBB08
start..stop
S start..stop
BspCIIBB 587 0 1..366 1..367
BaCIIBB07 573 0 1..366 1..366
BaCIIBB07_UAMH8258 572 0 1..366 1..366
PstrCIIBB02 560 0 1..366 1..359
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 373650..373710 61 N° 2 373441..373591 151 N° 3 373198..373389 192 N° 4 372942..373142 201
N° 5 372644..372885 242 N° 6 372413..372588 176 N° 7 372295..372359 65 N° 8 372225..372237 13
complement(join(372225..372237,372295..372359,372413..372588,372644..372885,3729 42..373142,373198..373389,373441..373591,373650..373710))


exon

Literature and cross-references BaCIIBB08
DNA ref. JGI genome:   scaffold_24 (373710..372225)
Protein sequence: BaCIIBB08
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   366 (345)
PWM (Da):   %s   38433.12 (36184.9)  
PI (pH):   %s   4.74 (4.66) Peptide Signal:   %s   cut: 22 range:22-366
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKQLLTAFSVALTLQVSQAAITKRVACPDGKNTATNAACCALFAVRDDIQANLFDGGECGEEVHESLRLTFHDAIGISPAIAKTGKFGGGGADGSIMVFDDIETAFHANNGVDEIIDEQKPFVAKHNMTAGDFIQFAGAVGVSNCPGAPRLNFFLGRPAPTAPAPDLTVPEPFDSVTKILARFDDAGHFTPAEVVALLASHTIAAADHVDETIPGTPFDSTPGIFDTQFFVETQLRGTLFPGTAGNQGEVMSPLAGEIRLQSDGDLARDSRTACEWQSFNNQAKIQSAFKAAFKKMSVLGHDINRMIDCSEVIPIPNNTPVKPAHLPAGNTLRDVQQCARSPFPSLSADPGPATSVAPVPPS

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAGCAACTCCTCACTGCCTTCTCGGTTGCGCTCACCCTCCAGGTGTCGCAAGGTCTGTCATCCTGTTGACCATGTTGCGGTACAAAACATTGACGAGGACATTTTTTCAGC
CGCTATTACCAAGCGTGTTGCGTGCCCTGACGGTAAGAACACTGCGACGAACGCGGCCTGCTGCGCTCTGTTCGCTGTTCGCGACGACATCCAGGCCAACCTCTTCGACGGTGGCGAATG
TGGAGAGGAAGTCCACGAGTCTCTTCGTTT
GTAAGAAATAGCGGTGTATCGTGTCTATGAATACGCTAACATTGTCATCAGGACTTTCCACGATGCCATTGGTATTTCCCCGGCCATTGC
AAAGACCGGAAAGTTCGGAGGAGGCGGCGCTGACGGCTCGATCATGGTCTTCGACGACATCGAGACCGCCTTCCACGCCAACAATGGTGTTGACGAGATCATTGACGAGCAAAAGCCATT
CGTGGCCAAGCACAACATGACCGCTGGTGACTT
GTACGTGTCATTGTTCGTCCCAGTCATGAGACGTCTGTTCTAATACGTACGACAGCATTCAATTCGCTGGTGCCGTCGGTGTCTCCA
ACTGCCCCGGAGCACCCAGGCTCAACTTCTTCCTTGGCCGCCCCGCCCCGACGGCCCCCGCTCCCGATCTGACTGTCCCAGAACCCTTCGACAGCGTCACCAAGATTCTTGCTCGCTTCG
ATGATGCTGGACACTTCACCCCCGCTGAGGTTGTCGCTCTCCTCGCTTC
GTAAGTTCAAGATTCATAATTTCCACCAACATCGCTAAGGCCCTTGTGAATTCTAGTCACACCATCGCGGC
TGCAGACCACGTTGACGAGACCATCCCCGGAACTCCGTTCGACTCCACGCCCGGCATCTTCGACACTCAGTTCTTCGTCGAGACTCAGCTCCGCGGCACGCTCTTTCCGGGTACCGCCGG
AAACCAGGGTGAGGTTATGTCGCCTCTGGCTGGTGAGATCCGCCTGCAGTCCGATGGTGACCTCGCCCGCGACTCCAGGACCGCTTGCGAATGGCAGTCTTTCGTCA
GTAAGTATCAGTA
TCTACTCATACAGCATAATCCGTCATAACACACGTTTTACAGACAACCAGGCCAAGATCCAGAGTGCTTTCAAGGCTGCCTTCAAGAAGATGTCCGTCCTCGGCCATGACATCAACCGGA
TGATCGACTGCTCTGAGGTCATTCCCATCCCCAACAACACGCCCGTCAAGCCCGCGCACCTTCCCGCAGGAAACACTCTGAGGGATGTCCAGCAGGCT
GTAAGTTTTCTCAAGTCTAGAC
GATTTTCGGGCTCAGGCTGACTCGCTTCTAGTGCGCCCGCTCTCCCTTCCCCTCGCTCTCCGCCGACCCGGGCCCGGCCACCTCTGTCGCCCCTGTGTAAGTCTCACCGTTTGCATTCTA
CCGACCCACAGCTAACTTGATGCTCGTTTACAGCCCCCCATCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAGCAACTCCTCACTGCCTTCTCGGTTGCGCTCACCCTCCAGGTGTCGCAAGCCGCTATTACCAAGCGTGTTGCGTGCCCTGACGGTAAGAACACTGCGACGAACGCGGCC
TGCTGCGCTCTGTTCGCTGTTCGCGACGACATCCAGGCCAACCTCTTCGACGGTGGCGAATGTGGAGAGGAAGTCCACGAGTCTCTTCGTTT
GACTTTCCACGATGCCATTGGTATTTCC
CCGGCCATTGCAAAGACCGGAAAGTTCGGAGGAGGCGGCGCTGACGGCTCGATCATGGTCTTCGACGACATCGAGACCGCCTTCCACGCCAACAATGGTGTTGACGAGATCATTGACGAG
CAAAAGCCATTCGTGGCCAAGCACAACATGACCGCTGGTGACTT
CATTCAATTCGCTGGTGCCGTCGGTGTCTCCAACTGCCCCGGAGCACCCAGGCTCAACTTCTTCCTTGGCCGCCCC
GCCCCGACGGCCCCCGCTCCCGATCTGACTGTCCCAGAACCCTTCGACAGCGTCACCAAGATTCTTGCTCGCTTCGATGATGCTGGACACTTCACCCCCGCTGAGGTTGTCGCTCTCCTC
GCTTC
TCACACCATCGCGGCTGCAGACCACGTTGACGAGACCATCCCCGGAACTCCGTTCGACTCCACGCCCGGCATCTTCGACACTCAGTTCTTCGTCGAGACTCAGCTCCGCGGCACG
CTCTTTCCGGGTACCGCCGGAAACCAGGGTGAGGTTATGTCGCCTCTGGCTGGTGAGATCCGCCTGCAGTCCGATGGTGACCTCGCCCGCGACTCCAGGACCGCTTGCGAATGGCAGTCT
TTCGTCA
ACAACCAGGCCAAGATCCAGAGTGCTTTCAAGGCTGCCTTCAAGAAGATGTCCGTCCTCGGCCATGACATCAACCGGATGATCGACTGCTCTGAGGTCATTCCCATCCCCAAC
AACACGCCCGTCAAGCCCGCGCACCTTCCCGCAGGAAACACTCTGAGGGATGTCCAGCAGGCT
TGCGCCCGCTCTCCCTTCCCCTCGCTCTCCGCCGACCCGGGCCCGGCCACCTCTGTC
GCCCCTGT
CCCCCCATCTTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGTATAAAAG ATGGGCTTGG CGAGAGCATA ACTCCAGCAC TCCTCCGGTG TTTCAATCAG CTCTCTACAG CTCGTCTTTG CAGCCATGGC CTTCAAGCAA CTCCTCACTG CCTTCTCGGT  TGCGCTCACC CTCCAGGTGT CGCAAGCCGC TATTACCAAG CGTGTTGCGT GCCCTGACGG TAAGAACACT GCGACGAACG CGGCCTGCTG CGCTCTGTTC GCTGTTCGCG ACGACATCCA  GGCCAACCTC TTCGACGGTG GCGAATGTGG AGAGGAAGTC CACGAGTCTC TTCGTTTGAC TTTCCACGAT GCCATTGGTA TTTCCCCGGC CATTGCAAAG ACCGGAAAGT TCGGAGGAGG  CGGCGCTGAC GGCTCGATCA TGGTCTTCGA CGACATCGAG ACCGCCTTCC ACGCCAACAA TGGTGTTGAC GAGATCATTG ACGAGCAAAA GCCATTCGTG GCCAAGCACA ACATGACCGC  TGGTGACTTC ATTCAATTCG CTGGTGCCGT CGGTGTCTCC AACTGCCCCG GAGCACCCAG GCTCAACTTC TTCCTTGGCC GCCCCGCCCC GACGGCCCCC GCTCCCGATC TGACTGTCCC  AGAACCCTTC GACAGCGTCA CCAAGATTCT TGCTCGCTTC GATGATGCTG GACACTTCAC CCCCGCTGAG GTTGTCGCTC TCCTCGCTTC TCACACCATC GCGGCTGCAG ACCACGTTGA  CGAGACCATC CCCGGAACTC CGTTCGACTC CACGCCCGGC ATCTTCGACA CTCAGTTCTT CGTCGAGACT CAGCTCCGCG GCACGCTCTT TCCGGGTACC GCCGGAAACC AGGGTGAGGT  TATGTCGCCT CTGGCTGGTG AGATCCGCCT GCAGTCCGAT GGTGACCTCG CCCGCGACTC CAGGACCGCT TGCGAATGGC AGTCTTTCGT CAACAACCAG GCCAAGATCC AGAGTGCTTT  CAAGGCTGCC TTCAAGAAGA TGTCCGTCCT CGGCCATGAC ATCAACCGGA TGATCGACTG CTCTGAGGTC ATTCCCATCC CCAACAACAC GCCCGTCAAG CCCGCGCACC TTCCCGCAGG  AAACACTCTG AGGGATGTCC AGCAGGCTTG CGCCCGCTCT CCCTTCCCCT CGCTCTCCGC CGACCCGGGC CCGGCCACCT CTGTCGCCCC TGTCCCCCCA TCTTAAATAA TTCGGCGAGA  GTTGTCGTGT CCTCATAGAA TCTTGCCGAC ACGCTATTTA GTTCATCCCT GTGATTTCGC GATCGTAGTA GATTGCAATA CCGTTGATCA ATTGATCTAC AATTGCCTCC GCGAAACTTG 
CTCGACCTGG ACTAGAAGCA AACTAGAAGC CGTCCTAGTG AAAAATCATC CAAAATAGTC TATATGCAAA CGGGAAG 

Retrieve as FASTA