Entry information : VcaGPx01
Entry ID 9741
Creation 2011-11-17 (Passaia Gisèle)
Last sequence changes 2011-11-17 (Passaia Gisèle)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-11-18 (Christophe Dunand)
Peroxidase information: VcaGPx01
Name VcaGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Viridiplantae Chlorophyta Chlorophyceae Volvocaceae Volvox
Organism Volvox carteri    [TaxId: 3067 ]
Cellular localisation N/D
Tissue type N/D
Inducer Oxidative stress
Repressor N/D
Best BLASTp hits
Perox score E-value VcaGPx01
start..stop
S start..stop
CreGPx03 304 5e-107 2..200 1..200
SobGPx01 245 1e-83 16..200 15..199
PtaGPx04 199 4e-66 34..201 2..171
OsGPx01 198 9e-66 39..202 3..167
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..156 156 N° 2 326..460 135 N° 3 769..910 142 N° 4 1138..1210 73
N° 5 1652..1690 39 N° 6 1910..1973 64  
join(1..156,326..460,769..910,1138..1210,1652..1690,1910..1973)


exon

Literature and cross-references VcaGPx01
Literature Prochnik SE, Umen J, Nedelcu AM, Hallmann A, Miller SM, Nishii I, Ferris P, Kuo A, Mitros T, Fritz-Laylin LK, Hellsten U, Chapman J, Simakov O, Rensing SA, Terry A, Pangilinan J, Kapitonov V, Jurka J, Salamov A, Shapiro H, Schmutz J, Grimwood J, Lindquist E, Lucas S, Grigoriev IV, Schmitt R, Kirk D, Rokhsar DS. Genomic analysis of organismal complexity in the multicellular green alga Volvox carteri.Science. 2010 Jul 9;329(5988):223-6.
DNA ref. GenBank:   XM_002950404
Cluster/Prediction ref. UniGene:   Vca.5783
Protein sequence: VcaGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   203
PWM (Da):   %s   21802.23  
PI (pH):   %s   10.29
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMLQSRIHARPATRIAARPARHHALKTQALFGFGGAKTAEPSTSEFYSFTVKDIDGKSFPLSTLKGKAVLVVNLASQCGFTPQYNELQAIYDKFGKQGFTVLGFPCNQFGAQEPGSNQSIKAFAKSQYGVTFPLMSKVDVNGPGAEPLFNWLKTQKGGVMGNDIKWNFSKFLVDKEGVVVGRYASTATPGSLEGDIRKALGA

Retrieve as FASTA  
Remarks Complete sequence from genomic and 19 ESTs (5 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGCTGCAATCCCGTATCCATGCTCGCCCGGCGACACGTATCGCGGCGCGCCCGGCACGCCACCATGCTTTGAAGACCCAAGCACTGTTTGGCTTTGGTGGCGCTAAAACTGCAGAG
CCGTCGACAAGCGAATTTTACAGCTTCACCGTTAAG
GTGTGAAGATCCAGCCAAATCTTGCATGTTGCCCAGCCCATACAGCGGTTTCTATTATTGCCGGCTACCAATCATAAGGAATTC
CTATTGTTTCATGGTTCCATGTTTCATGAGTAAATGTTGGCCTCAAGTTACTGTTCTCAGAGCTTGTGCGATGGGCGTTGCGCAGGACATCGATGGCAAGAGCTTCCCGCTATCGACCTT
GAAAGGCAAGGCTGTTTTAGTCGTCAACCTCGCTTCGCAGTGCGGCTTCACGCCCCAATACAACGAGCTGCAGGCCATCTATGATAAGTTTGGCAAGCAG
GTATGTTCTGCACCCCGCTC
CGGAACCGGTTCTTCCCTGTTCGGCCACGTCCAAGTGACCCGTGCTCCCCCTCATTCCAGTGCCAATCCCTTACCAGCTCCGAGGATGGATGTTATGGTCTTTCCCATCCTAATACCCCA
CGGGGGTTTCGCTCAACAGTTTGTGTAACGCATGCTCTCTTTGCATATTTCGGCGACTCCTTCCCTTCGCCCATTTGGCAGACGTTGTCGACTCTTTTTAGCGCCTAATCACTGACCTTC
GGCTGCTGACCTCGTTTCATGACTCCATGTCGCCCCTGATGCTAGCAGGGCTTTACCGTTCTGGGCTTCCCCTGCAACCAGTTCGGCGCACAGGAGCCCGGCTCCAACCAGTCAATCAAG
GCCTTCGCCAAATCCCAGTACGGAGTGACCTTCCCGCTGATGTCCAAGGTGGACGTGAATGGCCCTGGAG
GTAGGTGGATTACATTTCATTGAATAGTAGAGGACTTTCCGGCTAAACAG
TTTCACCAAAGCAGCAGTCTGCAGTGCAACTGCTTTTTTATAATCGGCCGTCCCCCGCTGAGTGGCCTGAGTGGTTCCTTACTTCGCTTGTGCCGTTATGGTCCCCTCGTGTGCGCATCA
TCACCTCTTCCAACACCACCTCTCGTCCGATGCACCGGTTTTCCTGCACCTCGGCAGCTGAGCCTCTGTTCAACTGGCTCAAGACGCAGAAGGGCGGTGTTATGGGTAATGACATCAAGT
GGAACTTCAG
GTGAGTGCATGACGACGGCGGGGAGGGGTGGGGGGTTTTAAGCAAGGCCGGATAAGGCGAAGCTGGCGGGGCGGCGTTTGCTAGAGGTTTGACATATTGAGGAATGGTCG
GACACTAATGAGCGAGGGCAGTGAAGGATCCGTGGGATCCAACGAAAGTGAAAGTGAAGCCTTTGGTCCTAGGCTCGAAAGGAATTTCAGAGCACCGCAAATGGGGATATGTGAGTTTTG
GGTCGCGAATAAAGCTGCTGCTGCGCGCTGTGCGCTGTACGCTGTACGAGACGGCGCGGGAGCTGTCGGTCTCGAACGAGGGGCCTGGGGGAATCAGGGGCGGTGCACCCCTTCGTTGCC
AATGCTTATCAAGGTGAACCCGTGCCCTGAGTTCCCTCGTCTAATCGTGTCGTGCCGTGTTGTGGCGACTTCCCCTCTGTACCCTTGACAGCAAATTCCTGGTGGACAAGGAGGGTGTTG
TGGTGGGCAG
GTGAGAGGGTTTACGGTAGGAAAGGGCAAAATCACCATCCGGGAAGAGCTACAGCGTTTACTGCTAGAGCGAGAGGAATGCTAAAGTGTAAACCAGGGTTTAAAGCTGGG
GATGCCTTGCTTCGTCCGACGCCGAACGTGTGCTGCTGACTTCGATTGGGTTTCAATTACAGCCGCAGGGAAACTGACCCTCCCTCCCTCCACCTGGACGTTATTTCAGGTATGCGTCCA
CGGCCACTCCGGGTTCCTTGGAGGGCGATATCCGCAAGGCCCTGGGGGCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGCTGCAATCCCGTATCCATGCTCGCCCGGCGACACGTATCGCGGCGCGCCCGGCACGCCACCATGCTTTGAAGACCCAAGCACTGTTTGGCTTTGGTGGCGCTAAAACTGCAGAG
CCGTCGACAAGCGAATTTTACAGCTTCACCGTTAAG
GACATCGATGGCAAGAGCTTCCCGCTATCGACCTTGAAAGGCAAGGCTGTTTTAGTCGTCAACCTCGCTTCGCAGTGCGGCTTC
ACGCCCCAATACAACGAGCTGCAGGCCATCTATGATAAGTTTGGCAAGCAG
GGCTTTACCGTTCTGGGCTTCCCCTGCAACCAGTTCGGCGCACAGGAGCCCGGCTCCAACCAGTCAATC
AAGGCCTTCGCCAAATCCCAGTACGGAGTGACCTTCCCGCTGATGTCCAAGGTGGACGTGAATGGCCCTGGAG
CTGAGCCTCTGTTCAACTGGCTCAAGACGCAGAAGGGCGGTGTTATG
GGTAATGACATCAAGTGGAACTTCAG
CAAATTCCTGGTGGACAAGGAGGGTGTTGTGGTGGGCAGGTATGCGTCCACGGCCACTCCGGGTTCCTTGGAGGGCGATATCCGCAAGGCCCTG
GGGGCATGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AACAGTTCGC TGTCTTCAAA CTGTGATTCA GGTTTAGGAA GGATGATGCT GCAATCCCGT ATCCATGCTC GCCCGGCGAC ACGTATCGCG GCGCGCCCGG CACGCCACCA TGCTTTGAAG  ACCCAAGCAC TGTTTGGCTT TGGTGGCGCT AAAACTGCAG AGCCGTCGAC AAGCGAATTT TACAGCTTCA CCGTTAAGGA CATCGATGGC AAGAGCTTCC CGCTATCGAC CTTGAAAGGC  AAGGCTGTTT TAGTCGTCAA CCTCGCTTCG CAGTGCGGCT TCACGCCCCA ATACAACGAG CTGCAGGCCA TCTATGATAA GTTTGGCAAG CAGGGCTTTA CCGTTCTGGG CTTCCCCTGC  AACCAGTTCG GCGCACAGGA GCCCGGCTCC AACCAGTCAA TCAAGGCCTT CGCCAAATCC CAGTACGGAG TGACCTTCCC GCTGATGTCC AAGGTGGACG TGAATGGCCC TGGAGCTGAG  CCTCTGTTCA ACTGGCTCAA GACGCAGAAG GGCGGTGTTA TGGGTAATGA CATCAAGTGG AACTTCAGCA AATTCCTGGT GGACAAGGAG GGTGTTGTGG TGGGCAGGTA TGCGTCCACG  GCCACTCCGG GTTCCTTGGA GGGCGATATC CGCAAGGCCC TGGGGGCATG AGGCTCCACC ACTTTGAGGA GCCGTCACGG GATGGAGTTG TCTGCCGGGA AGAGCGGCTG GCTCCTTCCC  CGCTGGGCCA TATCATATGG GGACTGGAGT GGATAGAAAT CCACTGAGTG GATATGGAAT GTGGTAGTTT TGGGATTTTG CATTTACTGA GAGATGTTGC CAATTGCACC GTTATGTTGT  CCAGGTCTAG GGGTTTGTGT CTCGTCGAGA TGAACGAAGG AGGGGTGGTG AAGCATGAAA AAAAGGGCTG AGAGACGAGT GAGGTGTGTG TGTGTGTGTG TGTGTGAGTA CAGATGGTCA  TAGCAGGTAA CATTGCAATG ATGACGCGGA GGGGAATGTG TTGCGCGTGT GATGAAATGT TGGACATGTC CAGCGCAGGA AGCATTTACA TGATATGTGC GTGCCGTACA TTTTCTGCAC  GTACAAGATC CGGCTCGCGT CGTGGCTTCG ACGACTGTCA TGATGGCTAA ACGTTTATAT ATTGCACAAT ACCAGCCAGT GAGTAACATG CCTTTAAAAC TAAAACCTCA CCTGTGTGAT  AGCTAAACTA TAATGACGGG AAAGATTGTG GCAAGTCAAC TGCTCCAAAC TTCCAAAGGA AGCCGAACGT CTCAAATGCA ACCAACAACC GTGGAAACGT CCACTCCGTG GACTAGTATG  CCATCAGTAC TAATTTAGCG TGTCAAGTCA TATGTTTGAC GCGTGTATGT TTGTATTTTT AACAAAGTAG TCTATTTCCA CATGCACTTC ACCAACTTGC TCGGCAAAAC AACTCCAAAA 
ACTGCCTTCC GTTTCCACTC AAGAGTGCAG GTCGAAGAAC AGAACTATCC GCGACGGCTG AT 

Retrieve as FASTA