Entry information : LmaGPx01
Entry ID 9742
Creation 2011-11-17 (Passaia Gisèle)
Last sequence changes 2011-11-17 (Passaia Gisèle)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-04-23 (Catherine Mathe (Scipio))
Peroxidase information: LmaGPx01
Name LmaGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Leptosphaeriaceae Leptosphaeria
Organism Leptosphaeria maculans    [TaxId: 5022 ]
Cellular localisation N/D
Tissue type N/D
Inducer Oxidative stress
Repressor N/D
Best BLASTp hits
Perox score E-value LmaGPx01
start..stop
S start..stop
PnoGPx 299 2e-105 1..168 55..221
ClunGPx01 294 4e-104 1..168 1..167
CberGPx01 293 1e-103 1..168 1..167
Ssrc1lsm3aGPx01 289 5e-102 1..168 1..167
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 641468..641510 43 N° 2 641705..641973 269 N° 3 642060..642251 192  
join(641468..641510,641705..641973,642060..642251)


exon

Literature and cross-references LmaGPx01
Protein ref. GenBank:   CBX98718.1
DNA ref. JGI genome:   lm_SuperContig_13_v2 (641468..642251)
Protein sequence: LmaGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   168
PWM (Da):   %s   18710.59  
PI (pH):   %s   8.03
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASATSFFDFKPLDKRAQPYDLSQLHGKVVLVVNTASKCGFTPQFAGLEKLYKDIKATPQGENFEILGFPCNQFGGQDPGSNDEIQEFCQVNYGVSFPVLGKVVNGDKADPVFEWLKNEKPGLMGLKRVKWNFEKFLVGKDGKVRGRWASTKKPEDLKKEIEEALKA

Retrieve as FASTA  
Remarks Complet sequence from genomic (Supercontig13, 2 introns)3 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTGCGACTAGTTTTTTCGACTTCAAGCCTTTGGATAGTATGCTTTTTTCTACACTTCTCTATCCTATTTTCATATCCTATCTAGCATTTACCACCCGCCCTGCGCAGTACGGA
ACAGTCTGTACTGAGTTGTCTCACGCCCCCCTCCTTCCCTCTCACCTCCTCCCCTTCATCCCAACCCCAACCAGCCCTCCACCAACCAAACCAACTAACCAACTTCCCCCAAAATAGAGC
GCGCCCAACCCTACGACCTCTCTCAACTGCACGGCAAAGTCGTCCTCGTCGTCAACACAGCCTCGAAATGCGGCTTCACCCCGCAATTCGCCGGCCTCGAGAAGCTCTACAAGGACATCA
AGGCCACGCCCCAGGGCGAAAACTTTGAAATCCTCGGCTTCCCCTGCAACCAGTTTGGCGGCCAGGATCCCGGGTCAAATGACGAGATTCAAGAGTTTTGCCAGGTAAACTACGGCGTTA
GTTTTCCCGTGCTGGGCAAAGTGGAT
GTAAGTCTTTTCCTCTCCTTTTTTTTCTATTCCTCACTCCTTTTATCCCCTTTCACCTCTCCGTGTCTAACGCAAAATCCTCCCAGGTCAACGG
CGACAAAGCCGACCCCGTCTTTGAATGGCTCAAGAACGAGAAGCCGGGCCTGATGGGCCTGAAGCGCGTCAAGTGGAACTTTGAAAAGTTTCTCGTCGGCAAGGATGGCAAGGTGCGCGG
CAGGTGGGCGAGTACGAAGAAGCCCGAGGATCTGAAGAAGGAGATTGAGGAGGCGCTCAAGGCG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTGCGACTAGTTTTTTCGACTTCAAGCCTTTGGATAAGCGCGCCCAACCCTACGACCTCTCTCAACTGCACGGCAAAGTCGTCCTCGTCGTCAACACAGCCTCGAAATGCGGC
TTCACCCCGCAATTCGCCGGCCTCGAGAAGCTCTACAAGGACATCAAGGCCACGCCCCAGGGCGAAAACTTTGAAATCCTCGGCTTCCCCTGCAACCAGTTTGGCGGCCAGGATCCCGGG
TCAAATGACGAGATTCAAGAGTTTTGCCAGGTAAACTACGGCGTTAGTTTTCCCGTGCTGGGCAAAGTGGAT
GTCAACGGCGACAAAGCCGACCCCGTCTTTGAATGGCTCAAGAACGAG
AAGCCGGGCCTGATGGGCCTGAAGCGCGTCAAGTGGAACTTTGAAAAGTTTCTCGTCGGCAAGGATGGCAAGGTGCGCGGCAGGTGGGCGAGTACGAAGAAGCCCGAGGATCTGAAGAAG
GAGATTGAGGAGGCGCTCAAGGCG

Retrieve as FASTA