Entry information : FoGPx01
Entry ID 9743
Creation 2011-11-17 (Passaia Gisèle)
Last sequence changes 2011-11-28 (Christophe Dunand)
Sequence status complete
Reviewer Passaia Gisèle
Last annotation changes 2013-09-06 (Catherine Mathe (Scipio))
Peroxidase information: FoGPx01
Name FoGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Fusarium
Organism Fusarium oxysporum    [TaxId: 5507 ]
Cellular localisation N/D
Tissue type N/D
Inducer Oxidative stress
Repressor N/D
Best BLASTp hits
Perox score E-value FoGPx01
start..stop
S start..stop
GmoGPx01 453 1e-164 1..241 1..243
GzGPx 356 3e-126 1..241 13..246
NhaeGPx01 338 3e-119 4..241 3..247
CgraGPx01 318 2e-111 57..238 55..236
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1385474..1385726 253 N° 2 1384917..1385389 473  
complement(join(1384917..1385389,1385474..1385726))


exon

Literature and cross-references FoGPx01
DNA ref. JGI genome:   Supercontig_2.8 (1385726..1384917)
Protein sequence: FoGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   241
PWM (Da):   %s   27316.96  
PI (pH):   %s   10.09
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSLWRATAPRWLTLRPSSSSSSRWLNKYYTTTATTSFRSPPFSPLNTKHNSPHQRNITHNHLRHLSTTSKMASATSFYDFKPLDKRGQEVPLADYKGKVVLIVNTASKCGFTPQYAGLEKLWTKLKEKYPEDFVILGFPCNQFGGQEPGTDDDIQEFCQLNYGVTFPIMQKTEVNGDNTNPLWAWLKDQQSGLLGLKRIKWNFEKFLVGRDGKVKGRWASTTKPESLEEPILKALAEKAEA

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron) 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCCTGTGGCGTGCTACTGCTCCTCGTTGGTTGACTTTACGGCCATCATCAAGTTCCAGTTCACGCTGGCTTAATAAATACTACACCACCACCGCTACGACTTCTTTTCGTTCCCCG
CCATTTTCACCTCTCAACACAAAACACAACAGTCCTCACCAGAGAAATATCACTCATAACCATCTTCGTCATCTGAGTACAACTTCAAAGATGGCTTCTGCTACTAGCTTTTATGACTTT
AAGCCTCTTGACA
GTATGTGTCTCCCCTCTCATACCCCGCCTTAACCACACCACTCTCATGATAGCCTTCTCATAACTCTCAACTAACACATTTCAGAGCGGGGTCAAGAGGTTCCCCTC
GCCGACTACAAGGGCAAGGTCGTCCTCATTGTCAACACAGCCTCCAAGTGCGGCTTCACTCCCCAGTATGCTGGTCTCGAGAAGCTCTGGACCAAGCTCAAGGAGAAGTACCCTGAGGAC
TTTGTCATTCTCGGCTTCCCCTGCAACCAGTTCGGTGGCCAAGAGCCCGGCACCGACGACGACATCCAGGAGTTCTGCCAGCTCAACTACGGCGTGACCTTCCCCATCATGCAGAAGACC
GAGGTCAACGGTGACAACACCAACCCTCTTTGGGCCTGGCTCAAGGACCAGCAGTCGGGTCTTTTGGGCCTCAAGCGCATCAAGTGGAACTTTGAGAAGTTCCTTGTTGGGCGTGATGGA
AAGGTCAAGGGACGCTGGGCTAGCACCACCAAGCCCGAGAGTCTGGAGGAGCCTATCCTGAAGGCTCTTGCGGAGAAGGCTGAGGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCCTGTGGCGTGCTACTGCTCCTCGTTGGTTGACTTTACGGCCATCATCAAGTTCCAGTTCACGCTGGCTTAATAAATACTACACCACCACCGCTACGACTTCTTTTCGTTCCCCG
CCATTTTCACCTCTCAACACAAAACACAACAGTCCTCACCAGAGAAATATCACTCATAACCATCTTCGTCATCTGAGTACAACTTCAAAGATGGCTTCTGCTACTAGCTTTTATGACTTT
AAGCCTCTTGACA
AGCGGGGTCAAGAGGTTCCCCTCGCCGACTACAAGGGCAAGGTCGTCCTCATTGTCAACACAGCCTCCAAGTGCGGCTTCACTCCCCAGTATGCTGGTCTCGAGAAG
CTCTGGACCAAGCTCAAGGAGAAGTACCCTGAGGACTTTGTCATTCTCGGCTTCCCCTGCAACCAGTTCGGTGGCCAAGAGCCCGGCACCGACGACGACATCCAGGAGTTCTGCCAGCTC
AACTACGGCGTGACCTTCCCCATCATGCAGAAGACCGAGGTCAACGGTGACAACACCAACCCTCTTTGGGCCTGGCTCAAGGACCAGCAGTCGGGTCTTTTGGGCCTCAAGCGCATCAAG
TGGAACTTTGAGAAGTTCCTTGTTGGGCGTGATGGAAAGGTCAAGGGACGCTGGGCTAGCACCACCAAGCCCGAGAGTCTGGAGGAGCCTATCCTGAAGGCTCTTGCGGAGAAGGCTGAG
GCTTAA

Retrieve as FASTA