Entry information : HjGPx01
Entry ID 9744
Creation 2011-11-17 (Passaia Gisèle)
Last sequence changes 2011-11-28 (Christophe Dunand)
Sequence status complete
Reviewer Passaia Gisèle
Last annotation changes 2013-09-06 (Catherine Mathe (Scipio))
Peroxidase information: HjGPx01
Name HjGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Hypocreaceae Hypocrea
Organism Hypocrea jecorina (Trichoderma reesei)    [TaxId: 51453 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HjGPx01
start..stop
S start..stop
TviGPx01 345 2e-121 21..263 30..255
TaspGPx01 333 3e-116 21..263 35..263
TatGPx01 325 3e-113 21..263 31..262
TharGPx01 320 2e-112 94..263 1..170
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 173709..174030 322 N° 2 173072..173541 470  
complement(join(173072..173541,173709..174030))


exon

Literature and cross-references HjGPx01
DNA ref. JGI genome:   scaffold_7 (174030..173072)
Protein sequence: HjGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   263
PWM (Da):   %s   29576.17  
PI (pH):   %s   9.69
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPRCPNSNLLVARTLPTARPRLAAPCRAPLLLLAAKRHQWTDSRVAYNISSASAFSTLHHHHHHRTTSSHHLQHHHQHQRAVALPTLNRLSSTMSSATSFFDFKVPDGADNEVDLSQYKGKVVLVVNTASKCGFTYQYKNLESVYQAIKKEYPDDFVVLGFPCNQFGSQEPGSNEEIQNFCSLEQKVTFPVMGKINVNGDDAHPLYKWLKKEKPGLLGLERVKWNFEKFLIGRDGKVIGRWASTTEPEKIQDKIIEAIKQPAP

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron) 10 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCCGTTGTCCAAATTCCAATTTGCTCGTCGCCCGGACTCTGCCAACGGCGAGACCCCGACTGGCAGCTCCGTGCCGTGCGCCACTACTACTACTAGCAGCAAAACGTCATCAGTGG
ACCGATTCCAGAGTCGCATATAATATATCCTCTGCCTCGGCCTTTTCGACTTTGCATCATCATCATCACCATCGCACCACCAGCTCGCATCACCTCCAGCATCACCACCAGCACCAGCGC
GCAGTTGCTCTTCCGACGCTTAACAGACTCTCCTCGACAATGTCTTCCGCCACCAGCTTTTTCGACTTCAAGGTGCCTGACG
GTAAGACTTCCCTTTCCCGTCGCTGAAATCCCACTTCG
CCAGCTTTTGCGACAGGATTGCGACAATCCCCGCAGTCTGCGCCAGCCATCATGCCACAACCGCAAACCCCATGCATAAATCATCTTCCTCGTTTGCTAACGAGCGCATCGTACTTCTCA
TCTTTATAGGCGCCGACAACGAAGTGGACTTGTCCCAGTACAAGGGCAAGGTCGTCCTCGTCGTCAACACCGCGTCCAAGTGCGGCTTCACCTACCAGTACAAGAACCTCGAGTCCGTCT
ACCAGGCCATCAAGAAGGAGTACCCCGACGACTTTGTCGTCCTCGGCTTCCCCTGCAACCAGTTCGGCTCCCAGGAGCCCGGCAGCAACGAGGAGATTCAGAACTTCTGCTCGCTCGAGC
AAAAGGTCACGTTCCCCGTCATGGGCAAGATCAACGTCAACGGCGACGACGCCCACCCGCTCTACAAGTGGCTCAAGAAGGAGAAGCCGGGTCTCCTCGGCTTGGAGAGGGTCAAGTGGA
ACTTTGAAAAGTTCCTGATCGGTCGCGATGGAAAGGTGATCGGCCGCTGGGCGAGCACGACGGAGCCGGAGAAGATTCAGGACAAGATTATCGAGGCCATTAAGCAGCCCGCGCCCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCCGTTGTCCAAATTCCAATTTGCTCGTCGCCCGGACTCTGCCAACGGCGAGACCCCGACTGGCAGCTCCGTGCCGTGCGCCACTACTACTACTAGCAGCAAAACGTCATCAGTGG
ACCGATTCCAGAGTCGCATATAATATATCCTCTGCCTCGGCCTTTTCGACTTTGCATCATCATCATCACCATCGCACCACCAGCTCGCATCACCTCCAGCATCACCACCAGCACCAGCGC
GCAGTTGCTCTTCCGACGCTTAACAGACTCTCCTCGACAATGTCTTCCGCCACCAGCTTTTTCGACTTCAAGGTGCCTGACG
GCGCCGACAACGAAGTGGACTTGTCCCAGTACAAGGGC
AAGGTCGTCCTCGTCGTCAACACCGCGTCCAAGTGCGGCTTCACCTACCAGTACAAGAACCTCGAGTCCGTCTACCAGGCCATCAAGAAGGAGTACCCCGACGACTTTGTCGTCCTCGGC
TTCCCCTGCAACCAGTTCGGCTCCCAGGAGCCCGGCAGCAACGAGGAGATTCAGAACTTCTGCTCGCTCGAGCAAAAGGTCACGTTCCCCGTCATGGGCAAGATCAACGTCAACGGCGAC
GACGCCCACCCGCTCTACAAGTGGCTCAAGAAGGAGAAGCCGGGTCTCCTCGGCTTGGAGAGGGTCAAGTGGAACTTTGAAAAGTTCCTGATCGGTCGCGATGGAAAGGTGATCGGCCGC
TGGGCGAGCACGACGGAGCCGGAGAAGATTCAGGACAAGATTATCGAGGCCATTAAGCAGCCCGCGCCCTAG

Retrieve as FASTA