Entry information : GluxCIIBB
Entry ID 9746
Creation 2011-11-18 (Christophe Dunand)
Last sequence changes 2011-11-18 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-11-07 (Christophe Dunand)
Peroxidase information: GluxCIIBB
Name GluxCIIBB
Class Other class II peroxidase type B    [Orthogroup: CIIBB001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Tricholomataceae Gymnopus
Organism Gymnopus luxurians    [TaxId: 206324 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GluxCIIBB
start..stop
S start..stop
LedCIIBB01 621 0 1..364 1..364
PcriCIIBB05 503 3e-180 9..364 10..358
PcriCIIBB07 499 1e-178 27..364 25..359
PoVP04_PC15 481 1e-171 1..364 1..357
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..61 61 N° 2 116..315 200 N° 3 366..391 26 N° 4 445..478 34
N° 5 531..606 76 N° 6 658..684 27 N° 7 736..827 92 N° 8 885..960 76
N° 9 1012..1048 37 N° 10 1103..1191 89 N° 11 1251..1320 70 N° 12 1378..1387 10
N° 13 1438..1473 36 N° 14 1526..1704 179 N° 15 1765..1804 40 N° 16 1862..1886 25
N° 17 1937..1949 13  
join(1..61,116..315,366..391,445..478,531..606,658..684,736..827,885..960,1012.. 1048,1103..1191,1251..1320,1378..1387,1438..1473,1526..1704,1765..1804,1862..188 6,1937..1949)


exon

Literature and cross-references GluxCIIBB
DNA ref. JGI genome:   scaffold_3 (184606..182658)
Protein sequence: GluxCIIBB
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   364 (343)
PWM (Da):   %s   37992.93 (35734.6)  
PI (pH):   %s   4.13 (4.05) Peptide Signal:   %s   cut: 22 range:22-364
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MILINLLGVFVIQAALHRANAIPRHDKRFACADGIHVTSNEACCQLFPIVDKLQSDFFDGGECGEEVHESLRLTFHDAIGFSPTAGVEPMVALLRSQI*KHNSMPVVLKISLMLKRVSWLLTTSLSVLETSFN*PVLLVAIAPVLPDLNICLADLLLWRLRQTC*FQNLTLWTRFLQDLQTPGSIPLRSLLSLDLIPSPQRMLLIPQSPAHLLIRLPICSTPRYSSRYN*EEHFSEPEETRAK*SPPWRGKYVYSRILSWRIPVQLATGSLLPITKLTYKPRSEPLWLSWQCLVRTRARLWIAQT*SRSRSLFRSLRVPTYFQTPLRMILNRLVPLLRSQFLLLFVLPLPSHLFHHX

Retrieve as FASTA  
Remarks Complete sequence from genomic (16 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATTTTAATCAACCTTCTTGGTGTTTTTGTCATCCAGGCTGCCCTACACCGCGCAAACGGTAAGAATTTAGCACTCATCAGGATCGATATTAGCGATTAATCAAGCGTTACAGCTATT
CCACGCCATGATAAACGTTTCGCGTGCGCCGACGGGATACATGTTACCTCTAACGAAGCCTGCTGCCAGTTGTTCCCCATCGTTGATAAGCTCCAGTCCGATTTCTTTGACGGAGGAGAA
TGTGGAGAAGAAGTACATGAATCCCTAAGGCTCACTTTTCACGATGCTATTGGGTTTTCCCCCACCGCAGGGTAC
GTAGTATTCTCTATTTCCAGGTTTTGGAAATTCATGGGCCTACAG
TGGAGGTGGAGCCGATGGTAGCATTATTACGGTTGTTGTCTATGTTGAACTCGCAACGATTCGACTAATGGAAGCATTCTTCAGTTCGCAAATATAGAAACACAATTCCATGCCAATGGT
TCGTTCAATCAATACGAAATGCAGTTTGTCAAGCTCATACTATTTATTAGGTGGTATTGAAGATATCGTTGATGCTCAAAAGAGTTTCATGGCTTCTAACAACATCACTATCAGTCCTGG
AGACTT
GTACGATCTCATACTTCCTGTTTGTATTCTTGCTAATGCGCGAGGCTGTAGCATTCAACTAGCCGGTGCTGTTGGTAGGTTACCACTACTGATAAAATATTGCGGCATTGAACT
GCGTGTAGGCGTGAGCAATTGCCCCGGTGCTCCCCGACTTGAATATTTGTTTGGCCGACCTCCTCCTGTGGCGGCTTCGCCAGACTTGTTGATTCCAGAACCTTTCGGTGATTTTCTTCC
CGTCCGCGCTCTGTCTGTCGACGTAAGCGCTAACAATCATTTAGACACTGTGGACTCGATTCTTGCAAGATTTGCAGACGCCGGGTTCAATTCCTCTGAGGTCGTTGCTCTCCTTGGATC
GTGAGTGTCGACTTTTACTAGATCTCGAGTGCCGCATTAATGTCTAAGTAGTCATACCGTCGCCGCAGCGGATGTTGTTGATCCCACAGTAAGGGCGCGAACATTCTCCATTCTTGCGGA
AGTATGCTGAGCAGCACTCTAGATCCCCGGCACACCTTTTGATTCGACTCCCAATTTGTTCGACACCCAGATATTCATCGAGGTACAATTGAGAGGAACACTTTTCCCTGGGTGAGAAAC
TGAGAAAAATTTCATGCTAATATCCTGAATTCAATCAATTGAACCACCAGAACCGGAGGAAACCAGGGCGAAGTAGAGTCCCCCGTGGCGGGGGAAATACGTTTACAGTCGGATTCTGAG
GTGAGTTGACAGCCGAAGGTCACTCGTGACTCGTACGTCCTGACTCGGACTTTGCAGTTGGCGAGAGGTGAATTATCTCACTACCAAACGAATATATAGATACTGAGATGTCCCAAGATT
CCCGTACAGCTTGCGACTGGCAGTCTTTTGCCA
GTGAGCATAATCCATATTTCACCTCCTAAAATAAAATCTTATCGCATTGTAGATAACCAAGCTCACCTACAAACCGCGTTCAGAGCC
GCTATGGCTAAGCTGGCAGTGCTTGGTCAGGACACGAGCTCGCTTGTGGATTGCTCAGACGTGATCCCGATCCCGGAGCCTCTTCCGATCGCTGCGGGTCCCCACTTACTTCCAGACACC
ACTCAGAATGATATTGAACAGGCT
GTAAGTCTTATCACCTTACCATGAAAGTTCTGGCTTATCTAGCTTTCATCAATCTCATAGTGTGCCACTGCTCCGTTCCCAGTTCTTGCTGCTCTT
CCTG
GTTAGTAAAAACATGTTTTACGCTGCTGACCCTCTCGTTCTCACTTGCTATCTGAAGGTCCTGCCACTTCCGTCGCACCTGTGTAAGTCAGTGACTTCTGCAGCAGTCAATATTCT
AATCCATTCGCTTCAGTCCACCATCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATTTTAATCAACCTTCTTGGTGTTTTTGTCATCCAGGCTGCCCTACACCGCGCAAACGCTATTCCACGCCATGATAAACGTTTCGCGTGCGCCGACGGGATACATGTTACCTCTAAC
GAAGCCTGCTGCCAGTTGTTCCCCATCGTTGATAAGCTCCAGTCCGATTTCTTTGACGGAGGAGAATGTGGAGAAGAAGTACATGAATCCCTAAGGCTCACTTTTCACGATGCTATTGGG
TTTTCCCCCACCGCAGGGTAC
GTGGAGCCGATGGTAGCATTATTACGTTCGCAAATATAGAAACACAATTCCATGCCAATGGTGGTATTGAAGATATCGTTGATGCTCAAAAGAGTTTCA
TGGCTTCTAACAACATCACTATCAGTCCTGGAGACTT
CATTCAACTAGCCGGTGCTGTTGGTAGCAATTGCCCCGGTGCTCCCCGACTTGAATATTTGTTTGGCCGACCTCCTCCTGTGG
CGGCTTCGCCAGACTTGTTGATTCCAGAACCTTTCG
ACACTGTGGACTCGATTCTTGCAAGATTTGCAGACGCCGGGTTCAATTCCTCTGAGGTCGTTGCTCTCCTTGGATCTCATACCG
TCGCCGCAGCGGATGTTGTTGATCCCACA
ATCCCCGGCACACCTTTTGATTCGACTCCCAATTTGTTCGACACCCAGATATTCATCGAGGTACAATTGAGAGGAACACTTTTCCCTGGAA
CCGGAGGAAACCAGGGCGAAGTAGAGTCCCCCGTGGCGGGGGAAATACGTTTACAGTCGGATTCTGAG
TTGGCGAGAGATTCCCGTACAGCTTGCGACTGGCAGTCTTTTGCCAATAACC
AAGCTCACCTACAAACCGCGTTCAGAGCCGCTATGGCTAAGCTGGCAGTGCTTGGTCAGGACACGAGCTCGCTTGTGGATTGCTCAGACGTGATCCCGATCCCGGAGCCTCTTCCGATCG
CTGCGGGTCCCCACTTACTTCCAGACACCACTCAGAATGATATTGAACAGGCT
TGTGCCACTGCTCCGTTCCCAGTTCTTGCTGCTCTTCCTGGTCCTGCCACTTCCGTCGCACCTGTTC
CACCATCATGA

Retrieve as FASTA