Entry information : GluxCIIBA
Entry ID 9747
Creation 2011-11-18 (Christophe Dunand)
Last sequence changes 2011-11-18 (Christophe Dunand)
Sequence status partial
Reviewer Catherine Mathe
Last annotation changes 2017-03-09 (Catherine Mathe)
Peroxidase information: GluxCIIBA
Name GluxCIIBA
Class Other class II peroxidase type A    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Tricholomataceae Gymnopus
Organism Gymnopus luxurians    [TaxId: 206324 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GluxCIIBA
start..stop
S start..stop
GluxMnP03 449 2e-160 1..255 1..250
GluxMnP02 361 8e-126 2..255 3..247
GluxMnP01 361 1e-125 1..262 1..250
CsuMnP12 285 2e-95 19..254 15..240
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 24071..24211 141 N° 2 23959..24010 52 N° 3 23862..23903 42 N° 4 23781..23820 40
N° 5 23547..23730 184 N° 6 23377..23496 120 N° 7 23273..23318 46 N° 8 23101..23165 65
N° 9 22936..23043 108  
complement(join(22936..23043,23101..23165,23273..23318,23377..23496,23547..23730 ,23781..23820,23862..23903,23959..24010,24071..24211))


exon

Literature and cross-references GluxCIIBA
DNA ref. JGI genome:   scaffold_141 (24211..22936)
Protein sequence: GluxCIIBA
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   265
PWM (Da):   %s   27921.75  
PI (pH):   %s   3.95
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MYSSNVLPLAARIISFATTIKAAPASQDAVCSDGTVMSNAICCDFIPLAQDLTENLFENECGETAHEVLHLSFRMCKIYDAIAFSQSLGPSVRGGADGSMLIFPDVESNYATNLGISDSINDLAPFLASGKYPTISASDMIQFGAAVAVGLCGTPQLEFLAGRQNTTAPAIDRLIPEPQDSVSTILARFEDVANLDSEDVVSLLISVKSSPVARADHVDPTLADAPFDTPFTFDSQFFLKTLLAPVGFPGTDSMCSILPSLQY*

Retrieve as FASTA  
Remarks Partial or pseudogen from genomic. Last 100 aa are missing.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTACTCATCGAACGTTCTTCCCCTCGCTGCCCGCATCATTAGTTTTGCAACTACAATCAAGGCAGCCCCTGCCTCACAAGATGCGGTCTGCTCTGATGGAACAGTCATGAGCAATGCA
ATATGTTGCGACTTCATTCCA
GTTTGTCTTTTTACATCATCTCTCATAGACTGGGACTTACTGACTTATGATTGGACCTAGCTTGCTCAAGATCTTACTGAGAATCTCTTCGAGAATGAA
TGCGGTGAAACAG
GTTAGTGGGGAGACAAATATGCTCAGAAAAAAAAATACCTATTTACCTTCTGCAGCTCATGAAGTTCTTCATCTAAGTTTTCGAATGTGCAAAATTTGTAAGGTTGA
TCATCCACATACCAATGGATATCTACACTAGATGATGCCATTGCTTTCTCCCAGTCCCTGGGCCCTTCTGTGTAAGTTCAAGGTGTGTAACTCAGCTTGCATACTAACCTTTTCTCAAAA
GCAGAGGGGGTGCAGACGGCAGTATGCTGATCTTCCCGGACGTCGAATCTAATTATGCCACCAACTTGGGTATCTCTGACAGCATCAATGATCTTGCTCCTTTCCTCGCTTCTGGGAAAT
ATCCCACCATCTCTGCCAGCGATATGATTCAATTCGGTGCTGCTGTGGCGGTTGGTCTCTGCCCT
GTGCACTTGTCTGTATTGATAAATGCACTTTTTTCTTATTAACCTTTTAGGGCAC
ACCTCAATTGGAATTTCTTGCTGGACGACAAAATACTACAGCACCTGCAATTGACAGATTGATTCCAGAACCTCAGGACTCGGTCTCCACTATCCTTGCTCGATTTGAGGATGTG
GTACA
TTCTTTATATCTCCGCCTATTAATACAGTAATTAATGTCCTAGTTGTGCTCAGGCAAACCTTGACAGTGAGGATGTTGTGTCATTATTGATATCAGTTAGTAACCAACTTGATCTAATTC
CCACCCATTTTTTATCCTGACTTCCCTTCCAGCACACAGGTTTGGTCTCATTTTATGATTGCTTGCCATTTCCTGGTCATCTGAAGAATCATCTCCAGTTGCGAGGGCTGACCATGTTGA
TCCCACCCTTGCTGATGCACCATTTGATTCG
GTGAGACAGATTTTCATGAGCTTCCGAGATGTCAAAAATTGACAATCTTCCTCATAGACTCCCTTCACTTTCGACTCGCAATTCTTCCT
CAAGACTCTTTTGGCTCCTGTAGGATTCCCTGGGACTGACAGTATGTGCTCAATATTGCCGTCATTGCAATACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTACTCATCGAACGTTCTTCCCCTCGCTGCCCGCATCATTAGTTTTGCAACTACAATCAAGGCAGCCCCTGCCTCACAAGATGCGGTCTGCTCTGATGGAACAGTCATGAGCAATGCA
ATATGTTGCGACTTCATTCCA
CTTGCTCAAGATCTTACTGAGAATCTCTTCGAGAATGAATGCGGTGAAACAGCTCATGAAGTTCTTCATCTAAGTTTTCGAATGTGCAAAATTTATGAT
GCCATTGCTTTCTCCCAGTCCCTGGGCCCTTCTGT
CAGAGGGGGTGCAGACGGCAGTATGCTGATCTTCCCGGACGTCGAATCTAATTATGCCACCAACTTGGGTATCTCTGACAGCATC
AATGATCTTGCTCCTTTCCTCGCTTCTGGGAAATATCCCACCATCTCTGCCAGCGATATGATTCAATTCGGTGCTGCTGTGGCGGTTGGTCTCTGCCCT
GGCACACCTCAATTGGAATTT
CTTGCTGGACGACAAAATACTACAGCACCTGCAATTGACAGATTGATTCCAGAACCTCAGGACTCGGTCTCCACTATCCTTGCTCGATTTGAGGATGTG
GCAAACCTTGACAGTGAGGAT
GTTGTGTCATTATTGATATCAGTTA
AATCATCTCCAGTTGCGAGGGCTGACCATGTTGATCCCACCCTTGCTGATGCACCATTTGATTCGACTCCCTTCACTTTCGACTCGCAATTCTTC
CTCAAGACTCTTTTGGCTCCTGTAGGATTCCCTGGGACTGACAGTATGTGCTCAATATTGCCGTCATTGCAATACTGA

Retrieve as FASTA