Entry information : TsPrx55 (Thhalv10014070m)
Entry ID 9772
Creation 2011-11-18 (Qiang Li)
Last sequence changes 2011-11-18 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-11-26 (Christophe Dunand)
Peroxidase information: TsPrx55 (Thhalv10014070m)
Name (synonym) TsPrx55 (Thhalv10014070m)
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Eutrema
Organism Thellungiella salsuginea (Eutrema salsugineum)    [TaxId: 72664 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TsPrx55
start..stop
S start..stop
BrPrx55-1Ab_other 572 0 1..334 1..332
BrPrx55-1Aa_other 566 0 13..334 1..322
BnPrx55-3_other 552 0 8..325 16..332
BnPrx55-2_other 550 0 9..334 7..334
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4628364..4628600 237 N° 2 4628085..4628276 192 N° 3 4627433..4628008 576  
complement(join(4627433..4628008,4628085..4628276,4628364..4628600))


exon

Literature and cross-references TsPrx55 (Thhalv10014070m)
DNA ref. Phytozome 11:   scaffold_2 (4628600..4627433)
Protein sequence: TsPrx55 (Thhalv10014070m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   335 (302)
PWM (Da):   %s   36518.85 (32599.2) Transmb domain:   %s   i13-30o
PI (pH):   %s   4.82 (5.00) Peptide Signal:   %s   cut: 33 range:33-334
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDTRDNDSTKHTMMMWFYLGMLFFCMVAESDARLTENFYASTCPNVELIVRQVVSTKIEQTFTTAPATLRMFFHDCFVGGCDASVMIASESGDAEKDAPDNLSLAGDGFDTVIKAKLAVEAQCPGLVSCADIMAMAARDVVVLAGGPEFKVELGRRDGLVSQASRVDGKIPGPDLDVRGLVDLFASHGLSMTDMIALSGAHTIGFSHCNRFAHRLYNFSALMPLDPTLDPAYAQQLMQTCPQGRSDPEIALDLDITTPRVFDNVYFQNLVARKGLFTSDQVLFNDFRSQATVVRFANSAEEFNSAFISAMRKLGRVGVKVGSQGEIRRDCSAFN*

Retrieve as FASTA  
Remarks Complete sequence fromm genomic (introns 1and 2). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATACTCGTGATAATGATTCAACAAAACACACGATGATGATGTGGTTCTATTTGGGGATGTTGTTCTTTTGCATGGTGGCCGAGTCGGATGCTCGATTGACGGAGAATTTCTACGCC
TCGACATGCCCTAACGTGGAACTCATCGTTCGACAAGTGGTTTCAACGAAAATCGAACAAACCTTCACCACGGCTCCGGCAACGTTACGGATGTTCTTCCACGACTGCTTCGTCGGT
GTA
TGTAGTCTTGTGTTGTGATCTTGAAACTTTTCTTGCATGTGTTCTTTTTTTGGTATTATAAAAGTTATGATTCATGTGATATAGGGATGTGATGCTTCTGTGATGATAGCATCCGAGAGT
GGAGACGCGGAGAAGGACGCTCCAGACAATCTATCTCTCGCCGGAGACGGATTCGACACTGTGATCAAGGCTAAGCTCGCTGTCGAAGCTCAATGTCCAGGCCTTGTGTCATGTGCCGAT
ATCATGGCTATGGCCGCCAGGGACGTCGTCGTCCTC
GTAAGTCAACAACGCTCCTCATTGACTTTTTCATTCGATTCGCCATGTCATATTAATAATGTGATAATATTGTTAGGCTGGAGG
GCCAGAGTTTAAGGTGGAGCTAGGGAGACGAGACGGGCTCGTGTCGCAGGCGTCTCGCGTGGACGGGAAGATACCTGGACCGGACCTAGACGTGAGAGGTTTGGTCGATCTATTCGCTAG
TCACGGGCTATCAATGACCGATATGATTGCTCTATCAGGCGCACACACCATCGGATTCTCTCACTGCAACCGTTTCGCTCACCGTCTCTACAACTTCTCAGCGTTGATGCCCTTGGATCC
CACTCTCGATCCGGCCTATGCACAGCAGCTGATGCAAACCTGCCCTCAAGGTCGGTCGGACCCCGAAATCGCCTTGGACCTGGACATAACCACCCCAAGAGTCTTCGACAACGTCTACTT
CCAGAACCTTGTGGCAAGGAAAGGCCTTTTTACCTCGGATCAAGTTCTGTTTAACGATTTCAGGTCTCAGGCTACGGTGGTCAGGTTTGCTAACAGTGCTGAAGAATTCAACAGCGCTTT
CATCTCCGCGATGAGGAAGCTTGGCCGCGTTGGAGTTAAAGTTGGGAGCCAAGGAGAGATTCGAAGGGACTGCTCTGCTTTTAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATACTCGTGATAATGATTCAACAAAACACACGATGATGATGTGGTTCTATTTGGGGATGTTGTTCTTTTGCATGGTGGCCGAGTCGGATGCTCGATTGACGGAGAATTTCTACGCC
TCGACATGCCCTAACGTGGAACTCATCGTTCGACAAGTGGTTTCAACGAAAATCGAACAAACCTTCACCACGGCTCCGGCAACGTTACGGATGTTCTTCCACGACTGCTTCGTCGGT
GGA
TGTGATGCTTCTGTGATGATAGCATCCGAGAGTGGAGACGCGGAGAAGGACGCTCCAGACAATCTATCTCTCGCCGGAGACGGATTCGACACTGTGATCAAGGCTAAGCTCGCTGTCGAA
GCTCAATGTCCAGGCCTTGTGTCATGTGCCGATATCATGGCTATGGCCGCCAGGGACGTCGTCGTCCTC
GCTGGAGGGCCAGAGTTTAAGGTGGAGCTAGGGAGACGAGACGGGCTCGTG
TCGCAGGCGTCTCGCGTGGACGGGAAGATACCTGGACCGGACCTAGACGTGAGAGGTTTGGTCGATCTATTCGCTAGTCACGGGCTATCAATGACCGATATGATTGCTCTATCAGGCGCA
CACACCATCGGATTCTCTCACTGCAACCGTTTCGCTCACCGTCTCTACAACTTCTCAGCGTTGATGCCCTTGGATCCCACTCTCGATCCGGCCTATGCACAGCAGCTGATGCAAACCTGC
CCTCAAGGTCGGTCGGACCCCGAAATCGCCTTGGACCTGGACATAACCACCCCAAGAGTCTTCGACAACGTCTACTTCCAGAACCTTGTGGCAAGGAAAGGCCTTTTTACCTCGGATCAA
GTTCTGTTTAACGATTTCAGGTCTCAGGCTACGGTGGTCAGGTTTGCTAACAGTGCTGAAGAATTCAACAGCGCTTTCATCTCCGCGATGAGGAAGCTTGGCCGCGTTGGAGTTAAAGTT
GGGAGCCAAGGAGAGATTCGAAGGGACTGCTCTGCTTTTAACTAA

Retrieve as FASTA