Entry information : TsPrx59 (Thhalv10014080m)
Entry ID 9773
Creation 2011-11-18 (Qiang Li)
Last sequence changes 2011-11-18 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-11-26 (Christophe Dunand)
Peroxidase information: TsPrx59 (Thhalv10014080m)
Name (synonym) TsPrx59 (Thhalv10014080m)
Class Class III peroxidase    [Orthogroup: Prx024]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Eutrema
Organism Thellungiella salsuginea (Eutrema salsugineum)    [TaxId: 72664 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TsPrx59
start..stop
S start..stop
AruPrx06 630 0 1..330 1..327
AlyPrx59 624 0 1..331 1..328
BstrPrx86 625 0 1..331 1..328
AhalPrx07 619 0 1..331 1..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6868629..6868853 225 N° 2 6868330..6868512 183 N° 3 6867720..6867882 163 N° 4 6867208..6867632 425
complement(join(6867208..6867632,6867720..6867882,6868330..6868512,6868629..6868 853))


exon

Literature and cross-references TsPrx59 (Thhalv10014080m)
DNA ref. Phytozome 11:   scaffold_2 (6868853..6867208)
Protein sequence: TsPrx59 (Thhalv10014080m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (303)
PWM (Da):   %s   35524.91 (32405.3) Transmb domain:   %s   i7-29o
PI (pH):   %s   7.59 (6.26) Peptide Signal:   %s   cut: 29 range:29-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKTQTKVMGGHVILTVFTLCMLCSGVRAQLSPDIYAKSCPNLMQIVRKQVMVALKAEMRMAASLIRLHFHDCFVNGCDASVLLDGTDSEKLAIPNVNSARGFEVVDTIKDAVENACPGVVSCADILTLAARDSVFLSGGPQWRVALGRKDGLVANQSSANNLPSPFEPLDAIIAKFVAVGLNVSDVVALSGAHTFGQAKCDVFSNRLFNFTGAGTPDATLESTLLSNLQTVCPVGGNGNQTAPLDRNSTDAFDNNYFKNLLEGKGLLSSDQILFSSDLAVNTTKRLVEAYSRSQYLFFRDFTCSMIRMGGITNLVNGSSGEVRKNCRVINN*

Retrieve as FASTA  
Remarks Complete sequence fromm genomic (3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAACACAAACCAAGGTGATGGGAGGACATGTCATTCTAACTGTTTTCACTCTCTGTATGCTTTGTTCAGGGGTTAGGGCACAGCTAAGCCCTGACATTTACGCTAAATCATGCCCG
AATCTTATGCAAATTGTCCGTAAACAAGTTATGGTCGCCCTGAAGGCCGAGATGCGGATGGCTGCTTCTCTCATTCGTCTTCATTTCCATGACTGCTTTGTTAAT
GTATGGAACGTCTTT
TTTTTCTTCTGTTAAATACTTTTTTACGTCAAGTTATTGTTACAATTGTTCCAAACACTTGTCATTATTTTATTAAAACGTTCGTTGAATGGAAATTTCAGGGGTGCGATGCGTCTGTAT
TGTTGGATGGAACCGATAGCGAGAAATTAGCTATCCCAAACGTGAACTCTGCGAGAGGATTTGAAGTAGTTGATACTATCAAAGACGCTGTGGAAAATGCATGTCCTGGTGTTGTTTCTT
GCGCTGATATACTCACTTTAGCCGCTCGCGACTCGGTTTTCTTA
GTAAGCCTTTTTGTTCCCACTTAACAAGTAACAACCTTACTATTTACTTAGATTTCAGAGGATCAGTAAAAAATGT
TGTGTTAGCGATTAATATTTACTAGTTTCCATATTACACGAGTTTTAGCTTTCAAGAAACAACAATTTATAATATGACTTAGGTAGTGATTATTCATAGTAATAAAAAATCATCACGTTT
AAGTTTGTCTTTATAAAAATGATTAGCTATTTCATTTTAACATGATAATAGAATTTATGATCATATATCTGTGAATATCGTTTTCTTTAAATAATTTATTTATTTATTTGTTAACTGATG
TGTTCTAGGCCGAAATTCATACATTTCTCTATCAGAATTTAAATAAATTTATTTCAAGCGCATACTCTCATATTATATGTGTTCTATTTATTTTATTTTTTTGGTCGCCTAAAACGGGAT
TTGATTTGCAGAGCGGAGGGCCTCAGTGGAGAGTGGCATTAGGAAGAAAAGATGGATTAGTGGCAAATCAGAGCAGTGCAAACAATCTCCCATCTCCTTTTGAACCTTTAGACGCTATTA
TTGCCAAGTTTGTAGCTGTAGGCCTTAACGTCAGCGACGTCGTAGCTTTATCAG
GTTTACTCATTTCTTCAATCATTTTTGGCCCATCTTTTCTTCTAAGTAGTTAATACTTATGCATGT
ATACGCATTTTTGTAACAAAGGAGCTCACACCTTTGGACAAGCAAAGTGTGACGTCTTCAGCAACCGGCTGTTCAACTTTACCGGCGCGGGAACTCCGGACGCAACACTTGAGTCAACAC
TCTTGTCCAATCTGCAAACAGTTTGCCCGGTCGGAGGAAATGGGAACCAAACAGCTCCCCTTGACAGGAACTCAACGGACGCATTCGACAACAATTATTTCAAGAACCTACTCGAAGGGA
AAGGTCTTTTGAGTTCTGATCAGATTTTGTTCTCGAGTGACTTGGCCGTGAACACAACAAAAAGACTTGTGGAGGCTTATAGCCGGAGCCAGTACTTGTTTTTCAGGGACTTCACTTGTT
CGATGATCAGAATGGGAGGTATTACGAATCTTGTTAATGGATCTAGTGGCGAGGTTAGGAAAAACTGCAGGGTTATTAATAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAACACAAACCAAGGTGATGGGAGGACATGTCATTCTAACTGTTTTCACTCTCTGTATGCTTTGTTCAGGGGTTAGGGCACAGCTAAGCCCTGACATTTACGCTAAATCATGCCCG
AATCTTATGCAAATTGTCCGTAAACAAGTTATGGTCGCCCTGAAGGCCGAGATGCGGATGGCTGCTTCTCTCATTCGTCTTCATTTCCATGACTGCTTTGTTAAT
GGGTGCGATGCGTCT
GTATTGTTGGATGGAACCGATAGCGAGAAATTAGCTATCCCAAACGTGAACTCTGCGAGAGGATTTGAAGTAGTTGATACTATCAAAGACGCTGTGGAAAATGCATGTCCTGGTGTTGTT
TCTTGCGCTGATATACTCACTTTAGCCGCTCGCGACTCGGTTTTCTTA
AGCGGAGGGCCTCAGTGGAGAGTGGCATTAGGAAGAAAAGATGGATTAGTGGCAAATCAGAGCAGTGCAAAC
AATCTCCCATCTCCTTTTGAACCTTTAGACGCTATTATTGCCAAGTTTGTAGCTGTAGGCCTTAACGTCAGCGACGTCGTAGCTTTATCAG
GAGCTCACACCTTTGGACAAGCAAAGTGT
GACGTCTTCAGCAACCGGCTGTTCAACTTTACCGGCGCGGGAACTCCGGACGCAACACTTGAGTCAACACTCTTGTCCAATCTGCAAACAGTTTGCCCGGTCGGAGGAAATGGGAACCAA
ACAGCTCCCCTTGACAGGAACTCAACGGACGCATTCGACAACAATTATTTCAAGAACCTACTCGAAGGGAAAGGTCTTTTGAGTTCTGATCAGATTTTGTTCTCGAGTGACTTGGCCGTG
AACACAACAAAAAGACTTGTGGAGGCTTATAGCCGGAGCCAGTACTTGTTTTTCAGGGACTTCACTTGTTCGATGATCAGAATGGGAGGTATTACGAATCTTGTTAATGGATCTAGTGGC
GAGGTTAGGAAAAACTGCAGGGTTATTAATAATTAG

Retrieve as FASTA