Entry information : TsPrx56 (Thhalv10014085m)
Entry ID 9775
Creation 2011-11-18 (Qiang Li)
Last sequence changes 2011-11-18 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-11-26 (Christophe Dunand)
Peroxidase information: TsPrx56 (Thhalv10014085m)
Name (synonym) TsPrx56 (Thhalv10014085m)
Class Class III peroxidase    [Orthogroup: Prx044]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Eutrema
Organism Thellungiella salsuginea (Eutrema salsugineum)    [TaxId: 72664 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TsPrx56
start..stop
S start..stop
BnPrx56-2_other 568 0 1..329 1..329
BrPrx56-1Ab_other 568 0 1..329 1..329
BrPrx56-1Aa_other 566 0 1..329 1..330
BnPrx56-1_other 566 0 1..329 1..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5012849..5013079 231 N° 2 5013182..5013367 186 N° 3 5013594..5013759 166 N° 4 5014342..5014748 407
join(5012849..5013079,5013182..5013367,5013594..5013759,5014342..5014748)


exon

Literature and cross-references TsPrx56 (Thhalv10014085m)
DNA ref. Phytozome 12:   scaffold_2 (5012849..5014748)
Protein sequence: TsPrx56 (Thhalv10014085m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (300)
PWM (Da):   %s   36241.43 (32819.7) Transmb domain:   %s   i7-24o
PI (pH):   %s   8.64 (8.74) Peptide Signal:   %s   cut: 30 range:30-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVTLKMSLSCFFLLQISLFLLFSFDPTNAHGLKVGFYDNTCPKAELIVMKSVSDVMKKDPTIGAPLLRMFFHDCFVRGCEGSVLLELKNKKDEKNAAPNLSIRGFEVIDNIKASLEKECPGVVSCSDVLALVARDAVVAMNGRSWGVETGRRDGRVTNINEANSNLPSPFDNITSLITQFHSKGLDKKDLAVLSGGHTVGIGHCPLIANRLYNFTGKGDSDPNLDSEYAARLKQKCKPTDTTTALEMDPGSFKTFDDSFFKLVSKRRGFFQSDAALLDNQETKSYVLKQTKNHGSTFFEDFGVSMVKMGRIGVLTGRVGEIRKKCTMVN*

Retrieve as FASTA  
Remarks Complete sequence fromm genomic (3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTACTTTGAAGATGTCTCTCTCTTGTTTCTTCCTCCTTCAAATATCGTTGTTCTTGCTCTTTTCGTTTGATCCAACCAACGCGCATGGATTGAAAGTCGGATTTTACGACAACACA
TGCCCAAAAGCCGAGCTTATTGTTATGAAGTCTGTCTCTGACGTGATGAAGAAGGATCCAACAATTGGAGCTCCTTTGCTTAGAATGTTCTTCCACGATTGTTTCGTCCGG
GTAATGTTT
TTTTCTCTTCATCACAAGATTCACAACCCTAATTTCAAATACGTGTTTTTGGTAGTTAATTTATCAGTCTAATGATTGAACCATGATGTTTAGGGATGCGAAGGGTCGGTCTTGCTAGAG
CTAAAGAATAAAAAAGACGAGAAGAACGCAGCTCCTAACCTTAGCATTCGAGGGTTTGAGGTCATAGACAATATCAAGGCATCTCTAGAAAAGGAGTGCCCAGGCGTTGTTTCTTGCTCT
GATGTATTGGCTCTTGTCGCTAGAGACGCAGTGGTTGCG
GTAAGTATAAATTTTAAGTATTAAGGGAGAATAATCTAGTACTATTACGTCGAGTTAACGAGTTCTTTCTTGCACGCTCTC
TTTATGTCTATTACAATGTTCACATAGTGATTAGAGACTCTATAAAGTATAAATTATATATCCTAGTGAAATATACGCCAGGCTATTTGCTATATATATTATATATATGGCATGTTTGGA
TTTTTAACAACCATTATATATTTAGATGAATGGAAGGTCGTGGGGAGTTGAAACGGGACGAAGAGACGGTCGGGTTACAAACATCAATGAGGCCAATTCGAACTTACCATCACCATTCGA
TAATATCACTAGCCTTATCACCCAGTTTCATTCCAAAGGCCTCGACAAGAAAGACCTCGCCGTGCTTTCAG
GTATATATATATAATAGAATCAGAATTATCATAAATTAATTCTAGAACA
ATGCTTCAAAAAGTATTTGGTATCGGGTTTTTAACCGAGATCTGACCGGAAAATTGCAAAACTAGTCTTAACTCAATTATTTTGACTTTTGACTTCAGAGATTGAAAATTTATCAGACTT
TATAAATCAGGTTTTGAATGAAGGCAGAGGAACAAAAAAGACAAATTAATTATTATTATTATTTTGATATCCACAAGTATTGTTAACAATAGACCAAATATAAAAACAAAAAGAGTGCCT
GCCGAGGCAATGTTTGATGGAAAAAGAAATATCTATAATTTATCTAGTCCGGCCCTCATTTAATTAAATTTATACGTGATCTGCCCCCATATACAATACGTTCTTTTTATTCATGCTATG
CATATAACAAAGGTTTCTAATTTCATTCTCAATTTTCTTATTTTCGCTAATGTCAGACAGTTATGTCTTTTAGAAGATTTAAAGATTAGTCTTGACTTCGGTTAGAATTTTGTTAAAAAA
TTAGAATAAATAATTCATTCTCAACTTAATTATATGTATTTCATATTTGAAAGGTGGGCACACGGTTGGGATCGGACATTGTCCTCTAATCGCAAACCGGCTCTACAATTTCACTGGAAA
AGGAGACAGCGATCCGAACTTAGACTCGGAATACGCAGCCAGGCTCAAACAAAAATGCAAGCCGACTGATACCACGACGGCTCTGGAAATGGATCCAGGGAGCTTCAAAACATTCGATGA
TAGCTTCTTCAAGCTTGTGTCTAAAAGAAGAGGGTTCTTTCAGTCTGATGCAGCTCTTTTAGACAACCAAGAAACTAAGTCTTATGTTCTCAAGCAAACGAAAAATCATGGCTCTACTTT
CTTCGAGGACTTTGGTGTCTCTATGGTGAAGATGGGTCGGATTGGGGTTTTAACGGGTCGGGTCGGGGAAATTCGGAAGAAGTGCACAATGGTTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTACTTTGAAGATGTCTCTCTCTTGTTTCTTCCTCCTTCAAATATCGTTGTTCTTGCTCTTTTCGTTTGATCCAACCAACGCGCATGGATTGAAAGTCGGATTTTACGACAACACA
TGCCCAAAAGCCGAGCTTATTGTTATGAAGTCTGTCTCTGACGTGATGAAGAAGGATCCAACAATTGGAGCTCCTTTGCTTAGAATGTTCTTCCACGATTGTTTCGTCCGG
GGATGCGAA
GGGTCGGTCTTGCTAGAGCTAAAGAATAAAAAAGACGAGAAGAACGCAGCTCCTAACCTTAGCATTCGAGGGTTTGAGGTCATAGACAATATCAAGGCATCTCTAGAAAAGGAGTGCCCA
GGCGTTGTTTCTTGCTCTGATGTATTGGCTCTTGTCGCTAGAGACGCAGTGGTTGCG
ATGAATGGAAGGTCGTGGGGAGTTGAAACGGGACGAAGAGACGGTCGGGTTACAAACATCAAT
GAGGCCAATTCGAACTTACCATCACCATTCGATAATATCACTAGCCTTATCACCCAGTTTCATTCCAAAGGCCTCGACAAGAAAGACCTCGCCGTGCTTTCAG
GTGGGCACACGGTTGGG
ATCGGACATTGTCCTCTAATCGCAAACCGGCTCTACAATTTCACTGGAAAAGGAGACAGCGATCCGAACTTAGACTCGGAATACGCAGCCAGGCTCAAACAAAAATGCAAGCCGACTGAT
ACCACGACGGCTCTGGAAATGGATCCAGGGAGCTTCAAAACATTCGATGATAGCTTCTTCAAGCTTGTGTCTAAAAGAAGAGGGTTCTTTCAGTCTGATGCAGCTCTTTTAGACAACCAA
GAAACTAAGTCTTATGTTCTCAAGCAAACGAAAAATCATGGCTCTACTTTCTTCGAGGACTTTGGTGTCTCTATGGTGAAGATGGGTCGGATTGGGGTTTTAACGGGTCGGGTCGGGGAA
ATTCGGAAGAAGTGCACAATGGTTAATTAA

Retrieve as FASTA