Entry information : TsPrx23 (Thhalv10016868m)
Entry ID 9784
Creation 2011-11-18 (Qiang Li)
Last sequence changes 2011-11-18 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-28 (Christophe Dunand)
Peroxidase information: TsPrx23 (Thhalv10016868m)
Name (synonym) TsPrx23 (Thhalv10016868m)
Class Class III peroxidase    [Orthogroup: Prx040]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Eutrema
Organism Thellungiella salsuginea (Eutrema salsugineum)    [TaxId: 72664 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TsPrx23
start..stop
S start..stop
BrPrx22-1Ab_other 606 0 1..350 1..350
BrPrx22-1Aa_other 604 0 1..350 1..350
AtPrx23 602 0 1..350 1..349
AlyPrx23 597 0 1..350 1..349
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 9733440..9733667 228 N° 2 9733840..9734031 192 N° 3 9734119..9734287 169 N° 4 9734708..9735171 464
join(9733440..9733667,9733840..9734031,9734119..9734287,9734708..9735171)


exon

Literature and cross-references TsPrx23 (Thhalv10016868m)
Literature Taji,T., Sakurai,T., Mochida,K., Ishiwata,A., Kurotani,A., Totoki,Y., Toyoda,A., Sakaki,Y., Seki,M., Ono,H., Sakata,Y., Tanaka,S. and Shinozaki,K. BMC Plant Biol. 8, 115 (2008).
DNA ref. Phytozome 12:   scaffold_10 (9733440..9735171)
EST ref. GenBank:   BAJ34392.1
Protein sequence: TsPrx23 (Thhalv10016868m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   351 (321)
PWM (Da):   %s   38135.02 (35132.6)  
PI (pH):   %s   6.25 (6.26) Peptide Signal:   %s   cut: 30 range:30-350
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGFSSSFSCSVMGALILGCLLLQASNSNAQLRPDFYFGTCPRVFDIIGNIIVDELASDPRIAASLLRMHFHDCFVNGCDASILLDNSTSFRTEKDAAPNANSVRGFDVIDRMKAEIERACPRTVSCADVLTIASQISVLLSGGPWWPVPLGRRDSVQAFFDLANTNLPSPFSTLAQLKASFAAVGLNRASDLVALSGGHTFGRAQCQFVTPRLYNFNNTNRPDPSLNPTYLAQLRALCPQNGNGTVLVNFDPVTPDFFDRQYYTNLLNGRGLIQSDQVLSSTPGADTIPLVQQYSSNTFVFFRAFVDAMIRMGNLAPSSGNTEIRLNCRVVNSRRIRSVDNEDDGVVSSI*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGTTTTCTTCTTCGTTTTCTTGCAGTGTTATGGGAGCCCTAATATTGGGTTGCCTTCTCCTTCAAGCATCAAACTCTAATGCTCAGTTGAGGCCTGATTTCTACTTCGGAACATGC
CCGCGTGTTTTCGATATCATTGGGAATATCATCGTTGATGAATTGGCCTCCGATCCTCGTATTGCCGCTAGCCTCCTTCGCATGCACTTCCATGACTGTTTTGTTAAT
GTAAGGACTTAC
TCAACTTATGTTTTTATACATACCAAAAAAATCCATGACGTATTCATGGACAAAACTAGTTTTACATACCATTTACATATATAGAATAGAGTACTATATAAAAGCCAATTTTGAATAAAC
AAATACAATGGTCATGTAATGTAAATGGTTTAATTTGTAGGGTTGTGACGCATCGATCCTGCTCGACAATTCCACATCGTTCCGGACCGAGAAAGATGCTGCTCCAAACGCAAATTCGGT
TAGAGGGTTTGATGTGATAGATAGAATGAAAGCCGAGATCGAGAGAGCTTGCCCAAGAACAGTGTCTTGTGCAGATGTTCTCACCATTGCTTCTCAAATATCAGTGCTTTTG
GTATGTAC
ATACCTACATGACTTACATTAATCCAAAAATGGTATATGAATATTGTAAATTTTGACGTTAATGTAATATTTTATATAGTCGGGAGGTCCATGGTGGCCAGTTCCGTTGGGGAGGAGAGA
CAGCGTACAAGCTTTCTTTGATCTGGCTAATACGAATCTTCCCTCTCCATTCTCCACTCTTGCTCAACTCAAAGCAAGTTTTGCTGCCGTTGGCCTTAACCGCGCCTCGGATCTAGTTGC
TCTTTCTG
GTAAATTTCCTCTTTTTTTTATCGTCTAAGATATACATTTTTGGTCTAGATATATACAATTCATTTTATATATTGATAGTTAGCTACATGCACTTCTCAGCTAAGTAAAAGA
TTTGGTTCATGAATTTTAAAACTAATTTGTAAATTTATAAATTTTAGGATATGTTTGAACGAAATTTGAATAATTTTGATTGGATATTTCTTCTCTCCTAACATGGGTTTTAACGTTGTA
ATAATATTATAAACGTTACGTTGGTCGAGCTAATTTGTGCTATTAGATCTATAATAGTATATATTGAAATATTTTCAAGGTTCATATCTTATATCATAAGATATTAATTAGTACATGGGT
TTAATTAGGCATATGAACATAAAGTAAAATGTATCTAAACCCTTTTTTATTTGTCAAAAAATGGTTAGGTGGTCACACGTTTGGAAGAGCACAATGTCAATTTGTGACACCTCGTCTCTA
CAACTTCAACAACACCAACAGACCAGACCCGAGTCTTAACCCAACTTACCTCGCCCAACTCCGTGCATTGTGCCCTCAAAACGGAAACGGCACCGTTCTGGTCAACTTCGACCCCGTGAC
TCCTGATTTTTTCGATAGGCAGTACTACACCAATCTACTTAATGGGAGAGGTCTGATTCAGAGTGATCAAGTACTGTCCTCGACTCCAGGAGCAGACACGATTCCACTTGTGCAACAATA
CAGCAGCAACACGTTTGTCTTCTTCCGAGCATTCGTTGATGCAATGATCAGGATGGGAAATCTTGCCCCTTCGTCTGGAAATACCGAGATAAGACTAAATTGTAGGGTTGTGAATTCGAG
AAGAATTAGGAGTGTGGACAATGAGGATGATGGTGTTGTGAGTTCCATTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGTTTTCTTCTTCGTTTTCTTGCAGTGTTATGGGAGCCCTAATATTGGGTTGCCTTCTCCTTCAAGCATCAAACTCTAATGCTCAGTTGAGGCCTGATTTCTACTTCGGAACATGC
CCGCGTGTTTTCGATATCATTGGGAATATCATCGTTGATGAATTGGCCTCCGATCCTCGTATTGCCGCTAGCCTCCTTCGCATGCACTTCCATGACTGTTTTGTTAAT
GGTTGTGACGCA
TCGATCCTGCTCGACAATTCCACATCGTTCCGGACCGAGAAAGATGCTGCTCCAAACGCAAATTCGGTTAGAGGGTTTGATGTGATAGATAGAATGAAAGCCGAGATCGAGAGAGCTTGC
CCAAGAACAGTGTCTTGTGCAGATGTTCTCACCATTGCTTCTCAAATATCAGTGCTTTTG
TCGGGAGGTCCATGGTGGCCAGTTCCGTTGGGGAGGAGAGACAGCGTACAAGCTTTCTTT
GATCTGGCTAATACGAATCTTCCCTCTCCATTCTCCACTCTTGCTCAACTCAAAGCAAGTTTTGCTGCCGTTGGCCTTAACCGCGCCTCGGATCTAGTTGCTCTTTCTG
GTGGTCACACG
TTTGGAAGAGCACAATGTCAATTTGTGACACCTCGTCTCTACAACTTCAACAACACCAACAGACCAGACCCGAGTCTTAACCCAACTTACCTCGCCCAACTCCGTGCATTGTGCCCTCAA
AACGGAAACGGCACCGTTCTGGTCAACTTCGACCCCGTGACTCCTGATTTTTTCGATAGGCAGTACTACACCAATCTACTTAATGGGAGAGGTCTGATTCAGAGTGATCAAGTACTGTCC
TCGACTCCAGGAGCAGACACGATTCCACTTGTGCAACAATACAGCAGCAACACGTTTGTCTTCTTCCGAGCATTCGTTGATGCAATGATCAGGATGGGAAATCTTGCCCCTTCGTCTGGA
AATACCGAGATAAGACTAAATTGTAGGGTTGTGAATTCGAGAAGAATTAGGAGTGTGGACAATGAGGATGATGGTGTTGTGAGTTCCATTTGA

Retrieve as FASTA