Entry information : TsPrx20 ( Thhalv10016900m)
Entry ID 9786
Creation 2011-11-18 (Qiang Li)
Last sequence changes 2011-11-18 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-05-11 (Christophe Dunand)
Peroxidase information: TsPrx20 ( Thhalv10016900m)
Name (synonym) TsPrx20 ( Thhalv10016900m)
Class Class III peroxidase    [Orthogroup: Prx050]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Eutrema
Organism Thellungiella salsuginea (Eutrema salsugineum)    [TaxId: 72664 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TsPrx20
start..stop
S start..stop
AhalPrx14 644 0 1..336 1..336
AlyPrx20 640 0 1..336 1..336
BrPrx20-1Aa_other 637 0 7..336 4..333
AtPrx20 637 0 1..336 1..336
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 8173388..8173612 225 N° 2 8173737..8173928 192 N° 3 8174011..8174604 594  
join(8173388..8173612,8173737..8173928,8174011..8174604)


exon

Literature and cross-references TsPrx20 ( Thhalv10016900m)
DNA ref. Phytozome 11:   scaffold_10 (8173388..8174604)
Protein sequence: TsPrx20 ( Thhalv10016900m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   337 (312)
PWM (Da):   %s   38073.55 (35333.9) Transmb domain:   %s   i9-31o
PI (pH):   %s   6.4 (5.43) Peptide Signal:   %s   cut: 25 range:25-336
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKIKLKKLWVSLIVVSMITTSALGDFGGQLVKRFYKESCPLAEEIVKHNVEVAILRDPRMAASLLRLQFHDCFVLGCDASVLLDTHGDMLSEKQATPNVNSLRGFEVIDYIKYLLEEACPLTVSCSDIITIAARDSVFLRGGPWWEVLLGRRDSLKASFSGANQYIPAPNSSLDSLIVNFKQQGLDIQDLIALSGAHTIGKARCLSFKQRIAQPNMEQTFYVDEFKRHSTFRRILRSQCKDSSRNNELSPLDLQTPAYFDNHYYINLLKGRGLLISDNVLVSEDHEGEIFKKVWEYAVDQDLFFQDFVESMLKMGNINVLTGIEGEIRENCRFVNV*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGATCAAGCTAAAGAAGCTATGGGTCTCTTTAATTGTGGTTTCTATGATCACGACCTCGGCTTTGGGAGACTTTGGAGGACAATTAGTAAAGAGATTCTACAAAGAGAGTTGCCCA
TTAGCTGAAGAAATCGTGAAGCATAATGTGGAGGTTGCTATTCTTAGAGATCCTCGTATGGCGGCTTCTCTTCTTCGTCTTCAGTTCCACGACTGCTTCGTCTTG
GTAAGAAATCGTCCC
TTAATCTTACACTCTTTCTCTCTATGACCATAACATTTTCAAGTTGTTTTACAGACTCTAATTTTAGCCTAGCTAGATTGTTTTACCGTGTTTGGTGTTTTGGTGTTAGGGTTGTGATGC
GTCTGTGCTCTTGGATACACATGGAGATATGTTAAGTGAGAAACAAGCAACTCCAAACGTTAACTCACTGCGTGGGTTTGAAGTAATCGATTACATAAAGTATCTCCTTGAAGAAGCTTG
TCCTTTAACAGTCTCTTGTTCCGATATCATCACCATAGCCGCTCGTGACTCTGTCTTCTTG
GTAATTTCCCCTTTAGGAATGTTTCTGCTTTAAGAGATACCTAAAGTGGTCAATTTTTT
AATTTCTAAAAATGGTATATCAGAGAGGTGGACCATGGTGGGAAGTTTTGCTAGGGAGAAGAGACTCATTGAAGGCAAGCTTCTCCGGCGCAAACCAATACATTCCGGCACCAAACTCTT
CCCTCGACAGTCTCATCGTAAACTTCAAGCAACAAGGCCTCGACATTCAAGATCTCATCGCTCTTTCGGGCGCTCATACAATAGGTAAAGCGAGATGCTTGAGCTTCAAGCAACGCATTG
CTCAACCAAACATGGAACAAACGTTCTACGTCGACGAGTTCAAGAGACACAGCACATTCCGACGAATCCTACGGTCACAGTGCAAAGACTCTAGCCGCAATAACGAACTGTCACCGTTGG
ATTTACAGACACCAGCTTACTTTGATAACCATTATTACATTAATCTTTTAAAGGGAAGAGGGCTGTTGATTTCTGATAACGTTTTGGTCAGTGAAGATCATGAAGGAGAGATCTTCAAGA
AGGTTTGGGAGTATGCGGTGGATCAAGATCTCTTCTTCCAAGATTTTGTGGAATCAATGTTGAAAATGGGTAATATTAATGTGCTTACAGGTATTGAAGGTGAAATTAGAGAAAATTGTA
GATTCGTCAATGTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGATCAAGCTAAAGAAGCTATGGGTCTCTTTAATTGTGGTTTCTATGATCACGACCTCGGCTTTGGGAGACTTTGGAGGACAATTAGTAAAGAGATTCTACAAAGAGAGTTGCCCA
TTAGCTGAAGAAATCGTGAAGCATAATGTGGAGGTTGCTATTCTTAGAGATCCTCGTATGGCGGCTTCTCTTCTTCGTCTTCAGTTCCACGACTGCTTCGTCTTG
GGTTGTGATGCGTCT
GTGCTCTTGGATACACATGGAGATATGTTAAGTGAGAAACAAGCAACTCCAAACGTTAACTCACTGCGTGGGTTTGAAGTAATCGATTACATAAAGTATCTCCTTGAAGAAGCTTGTCCT
TTAACAGTCTCTTGTTCCGATATCATCACCATAGCCGCTCGTGACTCTGTCTTCTTG
AGAGGTGGACCATGGTGGGAAGTTTTGCTAGGGAGAAGAGACTCATTGAAGGCAAGCTTCTCC
GGCGCAAACCAATACATTCCGGCACCAAACTCTTCCCTCGACAGTCTCATCGTAAACTTCAAGCAACAAGGCCTCGACATTCAAGATCTCATCGCTCTTTCGGGCGCTCATACAATAGGT
AAAGCGAGATGCTTGAGCTTCAAGCAACGCATTGCTCAACCAAACATGGAACAAACGTTCTACGTCGACGAGTTCAAGAGACACAGCACATTCCGACGAATCCTACGGTCACAGTGCAAA
GACTCTAGCCGCAATAACGAACTGTCACCGTTGGATTTACAGACACCAGCTTACTTTGATAACCATTATTACATTAATCTTTTAAAGGGAAGAGGGCTGTTGATTTCTGATAACGTTTTG
GTCAGTGAAGATCATGAAGGAGAGATCTTCAAGAAGGTTTGGGAGTATGCGGTGGATCAAGATCTCTTCTTCCAAGATTTTGTGGAATCAATGTTGAAAATGGGTAATATTAATGTGCTT
ACAGGTATTGAAGGTGAAATTAGAGAAAATTGTAGATTCGTCAATGTCTGA

Retrieve as FASTA