Entry information : TsPrx25 (Thhalv10016924m)
Entry ID 9788
Creation 2011-11-18 (Qiang Li)
Last sequence changes 2011-11-18 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-30 (Christophe Dunand)
Peroxidase information: TsPrx25 (Thhalv10016924m)
Name (synonym) TsPrx25 (Thhalv10016924m)
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Eutrema
Organism Thellungiella salsuginea (Eutrema salsugineum)    [TaxId: 72664 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TsPrx25
start..stop
S start..stop
BrPrx25-1Aa_other 633 0 1..326 1..326
BstrPrx81 624 0 1..326 1..326
BrPrx25-1Ab_other 623 0 1..326 1..326
AalpPrx25 620 0 1..326 1..325
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 11227687..11227902 216 N° 2 11227428..11227607 180 N° 3 11227186..11227348 163 N° 4 11225750..11226171 422
complement(join(11225750..11226171,11227186..11227348,11227428..11227607,1122768 7..11227902))


exon

Literature and cross-references TsPrx25 (Thhalv10016924m)
DNA ref. Phytozome 12:   scaffold_10 (11227902..11225750)
Protein sequence: TsPrx25 (Thhalv10016924m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (302)
PWM (Da):   %s   35325.94 (32572.5)  
PI (pH):   %s   7.34 (7.36) Peptide Signal:   %s   cut: 25 range:25-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGVYLGNYCYVIIIVLVLGKEVISQSLSNGYYSTSCPKAESIVRSTVESHFDSDPTISPGLLRLHFHDCFVQGCDGSVLIKGKSAEQAALANGGLRGFEVIDDAKARLESECPGVVSCADILALAARDAVDLSSGPSWRVPTGRKDGRISLASEASNLPSPLDSVAVQKQKFQNKGLDTHDLVTLLGAHTIGQTDCQFFRYRLYNFTVTGNSDPTISPSFLTQLKTLCPPNGDGSKRVALDIGSPSKFDVSFFKNLRDGNAILESDQRLWSDAETKDVVKKYASTIRGLLGFRFDNEFGKAMVKMSSIDVKTDVNGEVRKVCSKVN*

Retrieve as FASTA  
Remarks Complete sequence fromm genomic (3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAGTGTACTTAGGCAACTACTGTTATGTAATTATAATAGTATTGGTGTTGGGAAAAGAAGTGATAAGTCAGTCGTTAAGTAATGGTTATTATTCAACTTCATGTCCCAAAGCTGAG
TCAATAGTAAGATCCACCGTTGAATCTCACTTTGATTCTGATCCCACTATTTCTCCTGGCCTGCTTAGGCTTCATTTCCATGACTGTTTTGTTCAG
GTTCCAAATCTTCTTTAATCTCAT
TCTTCTCTAAGCAATTATACAAGTTAACTGAATGTTGAATTTGACCTATTATTAGGGTTGTGATGGATCGGTCTTAATCAAAGGGAAATCTGCCGAGCAAGCAGCTCTCGCTAATGGCGG
TCTTAGAGGTTTTGAGGTGATAGATGATGCGAAAGCCCGGCTAGAGTCAGAGTGTCCAGGAGTGGTGTCATGTGCAGATATACTTGCACTTGCTGCTCGTGACGCTGTTGACTTG
GTACG
CAAGTTTACTAAACCTAATTAGGGTTTACTTAAATTCTTTGGAAGATTATTTATTAATTACGTATGGAAAACAGAGTTCAGGGCCAAGCTGGCGAGTTCCAACGGGTCGTAAAGACGGGA
GAATCTCGTTAGCGTCGGAGGCATCGAATCTACCTTCGCCACTTGACTCTGTTGCTGTTCAAAAGCAAAAGTTTCAAAACAAAGGATTGGATACTCATGATCTCGTCACTCTACTCG
GTT
TGTTTTTCATCTCTCTGTCTTTTTTCTTTCTTTTTAGAAAATCTAACTTCTTGCTTTGACATCCATAATTTATATTCTACTAATTTCCCGCAAGAGAAGAGTCTATCTAATTTTTCGTTT
AAGAATCATATTTTCATTTTTCGATCATTTAACTTTTTATATTTTTATGAGTAATTGTTTTGTTCATCGGTATTTTTATCCATAGTTGCGGATCATTAGGACTTTAACTAAATCCGGATG
CAGAACGCGCTATCCATTAGTTAAACCACTACATTGAAAAATATGATTCATGAGTAAGTAGTTCATAGCTGTTAATAGCCTGTTATGCTAAATCCTACTATATACAGATATATGTTTAAA
AGAAACATAAAGTTCGAAATTTGAAAACAAATTTATGCACAAAAAACGCCAACATGGAAAAAAGTTTAAGTGCCTAAAAGTTGTAGTATGCCTTGTTTCATTTTATACTTTTTTCTTGGA
TTTTAAGCAAAGGATCATTACACAATTAATCGTTGATTTGAGGAGGAAGATTTGAAATTGAAAAACACCTTAGCCACCGTCTTTCACAAAATCGATCAAGAAAATTATTAACTCGGAAGA
TTAAAGTCATCTTTTCTTTGACGTATGTTAGATCGATCGTATTTGATCCTGACGAGGGTACGTCATAAAGTCCTAATGATCCGCAACTATAGATGCTTTGTTTTAAAAAGTTAGCTTTTT
ATTCAGTAATTGTATTTTTTTTAGTTGAAAAGAACATAAAAATGAATGTTTTGAAATATCTAAAATGATTAATTATCTGGTTGAAATTTTTACTTCAAAAAACGCTGGTACGTAGTAGCT
GCTGAAGTTTAGAAATAAAAGTAAACTGAGACACTTGCTATTAGCCCATCTTGATCTTCTTCTTCATATTTTTTTTCTTTCTAAAATTTACACCTGCTTCTCTTGTCTCTAATGAACATG
CATGTGCCATTTATCTTTTCTCTCCAAAATAATAACACATTATATATGCAGGTGCACATACAATAGGACAAACGGACTGTCAATTCTTCCGTTACCGTCTATACAACTTCACGGTGACCG
GAAACTCCGACCCAACCATAAGCCCATCGTTTCTTACGCAGCTCAAGACTCTTTGTCCTCCCAATGGAGACGGTTCAAAACGTGTTGCTCTTGACATTGGCAGTCCCTCGAAATTTGATG
TTAGCTTCTTCAAGAACCTACGAGATGGTAACGCCATTTTGGAGTCGGACCAACGGCTTTGGTCGGACGCCGAGACAAAAGACGTGGTGAAGAAGTATGCGAGTACTATTAGGGGTTTGT
TAGGGTTTAGGTTTGATAATGAGTTTGGTAAAGCTATGGTTAAGATGAGTTCCATTGATGTAAAGACAGACGTCAATGGTGAGGTTAGGAAAGTTTGTTCCAAGGTGAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAGTGTACTTAGGCAACTACTGTTATGTAATTATAATAGTATTGGTGTTGGGAAAAGAAGTGATAAGTCAGTCGTTAAGTAATGGTTATTATTCAACTTCATGTCCCAAAGCTGAG
TCAATAGTAAGATCCACCGTTGAATCTCACTTTGATTCTGATCCCACTATTTCTCCTGGCCTGCTTAGGCTTCATTTCCATGACTGTTTTGTTCAG
GGTTGTGATGGATCGGTCTTAATC
AAAGGGAAATCTGCCGAGCAAGCAGCTCTCGCTAATGGCGGTCTTAGAGGTTTTGAGGTGATAGATGATGCGAAAGCCCGGCTAGAGTCAGAGTGTCCAGGAGTGGTGTCATGTGCAGAT
ATACTTGCACTTGCTGCTCGTGACGCTGTTGACTTG
AGTTCAGGGCCAAGCTGGCGAGTTCCAACGGGTCGTAAAGACGGGAGAATCTCGTTAGCGTCGGAGGCATCGAATCTACCTTCG
CCACTTGACTCTGTTGCTGTTCAAAAGCAAAAGTTTCAAAACAAAGGATTGGATACTCATGATCTCGTCACTCTACTCG
GTGCACATACAATAGGACAAACGGACTGTCAATTCTTCCGT
TACCGTCTATACAACTTCACGGTGACCGGAAACTCCGACCCAACCATAAGCCCATCGTTTCTTACGCAGCTCAAGACTCTTTGTCCTCCCAATGGAGACGGTTCAAAACGTGTTGCTCTT
GACATTGGCAGTCCCTCGAAATTTGATGTTAGCTTCTTCAAGAACCTACGAGATGGTAACGCCATTTTGGAGTCGGACCAACGGCTTTGGTCGGACGCCGAGACAAAAGACGTGGTGAAG
AAGTATGCGAGTACTATTAGGGGTTTGTTAGGGTTTAGGTTTGATAATGAGTTTGGTAAAGCTATGGTTAAGATGAGTTCCATTGATGTAAAGACAGACGTCAATGGTGAGGTTAGGAAA
GTTTGTTCCAAGGTGAATTAA

Retrieve as FASTA