Entry information : TsAPx06 (Thhalv10018581m)
Entry ID 9789
Creation 2011-11-18 (Qiang Li)
Last sequence changes 2011-11-18 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-30 (Christophe Dunand)
Peroxidase information: TsAPx06 (Thhalv10018581m)
Name (synonym) TsAPx06 (Thhalv10018581m)
Class Ascorbate peroxidase    [Orthogroup: APx002]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Eutrema
Organism Thellungiella salsuginea (Eutrema salsugineum)    [TaxId: 72664 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TsAPx06
start..stop
S start..stop
AlyAPx06 726 0 1..434 1..429
AtAPx06 716 0 1..434 1..426
AhalAPx08 714 0 1..434 1..424
CagraAPx06 708 0 1..434 1..430
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1393683..1393877 195 N° 2 1393475..1393609 135 N° 3 1393238..1393358 121 N° 4 1393061..1393161 101
N° 5 1392876..1392963 88 N° 6 1392695..1392762 68 N° 7 1392505..1392591 87 N° 8 1392328..1392402 75
N° 9 1392132..1392209 78 N° 10 1391949..1392053 105 N° 11 1391751..1391825 75 N° 12 1391484..1391660 177
complement(join(1391484..1391660,1391751..1391825,1391949..1392053,1392132..1392 209,1392328..1392402,1392505..1392591,1392695..1392762,1392876..1392963,1393061. .1393161,1393238..1393358,1393475..1393609,1393683..1393877))


exon

Literature and cross-references TsAPx06 (Thhalv10018581m)
Literature Taji,T., Sakurai,T., Mochida,K., Ishiwata,A., Kurotani,A., Totoki,Y., Toyoda,A., Sakaki,Y., Seki,M., Ono,H., Sakata,Y., Tanaka,S. and Shinozaki,K. BMC Plant Biol. 8, 115 (2008).
DNA ref. Phytozome 11:   scaffold_9 (1393877..1391484)
EST ref. GenBank:   BAJ34299 [3' end]
Protein sequence: TsAPx06 (Thhalv10018581m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   435
PWM (Da):   %s   47298.88 Transmb domain:   %s   o406-425i
PI (pH):   %s   8.19
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFSLSAASHSSLCSSASTKVSLSPAVSSSAPLVALSSSSSQPHSFSSLRSVKSSSLFPHFSFTQRKYPINGTKNRGCSTKCAASDAAQLRSAKEDIKVLLRTKFCHPIFVRLGWHDAGTYNKNIEEWPQRGGANGSLRFEAELKHAANAGLISALNLIQPIKDKYSNISYADLFQLASATAVEAGGPEIPMKYGRVDVSVPDQCPEEGRLPDAGPPSPADHLRDVFYRMGLNDEIVALSGAHTLGRARPERSGWGKPETKYTKTGPGEAGGQSWTVKWLKFDNSYFKDIKEKRDEDLLVLPTDAALFEDPSFKNYAEKYAEDPAAFFKDYAEAHAKLSNLGAKFDPPEGIIIDNDPAQGTPEKFVAAKYSTGKKELSESMKKKIRAEYEAIGGSPNKPLPTNYFLNIIIAISVLVLLFTFFGNNNSDYSGF*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTTTCTCTCTCCGCCGCTTCTCACTCATCACTCTGCTCCTCCGCCTCCACCAAAGTCTCTCTTTCCCCCGCCGTCTCTTCCTCAGCCCCTCTCGTTGCTCTTTCTTCCTCTTCA
TCACAACCACATTCTTTCTCTTCTCTCCGAAGCGTCAAATCTTCCTCTCTATTTCCACATTTCTCCTTTACTCAG
GTAATCAATCGCCGAATTTCGGTTTCGGAATCAGAAGAAATTTGT
AAAGTTTAACAATTTGTGTTGGTTACAGAGAAAATATCCGATTAATGGGACGAAGAACAGAGGTTGTAGCACGAAATGTGCCGCCTCTGATGCAGCTCAATTGAGAAGCGCTAAAGAAGA
TATCAAAGTTCTTCTCCGGACAAAGTTTTGCCATCCGATATTC
GTTGAGTATCCTTTGTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTATCCCTTGATTTTGAAGAATTGAAATTC
TTGTGCTTTTGTCTTTTGACAAATATTTACATTTTGCAGGTCAGGTTGGGATGGCACGATGCTGGCACATATAACAAGAACATCGAGGAGTGGCCACAGAGAGGTGGAGCTAATGGAAGT
CTTAGATTTGAGGCTGAGCTTAAGCATGCTGCAAATGCTG
GTATACACTTGTTTTGTCTTTAGCCTCCTCAAGACTTGCTTTTGTTTTACCGCTTTTTCATCTTTACATTCTACAGGTCT
CATTAGTGCGTTAAATCTAATTCAGCCTATCAAAGACAAGTATTCTAACATCTCTTACGCCGACTTATTCCAGTTAGCTAGTGCCACTGCAGTGGAG
GTCGTCCTAAAAGTTTACATTAT
TCTGAATTAGCTAGTGTGATACTAAGTTGGTCTTGAAAATTTACTGATAACTTTAGATAAAAAAAAAACTTCAGGAGGCTGGTGGTCCTGAGATCCCGATGAAATATGGGAGAGTTGATG
TCTCGGTACCAGACCAATGTCCAGAAGAAGGAAGACTCCCTG
GTTAAACTAATCTTTTAGCATTGTCTGTTTTCTTGGCTTCGATTGAGTTTGTTTTCAGATTTTGTTTATGGAATAATT
GAAATAACGAGGGTGAAAATTTATGTTATGTTTAGATGCTGGACCGCCTTCACCAGCTGATCATTTGAGAGATGTATTCTACAGAATGGGACTCAATGATCAGGTCGTTTTTTTTTTTTT
TTTGTCTCATTTTCTGTTGCTCATGTCAAACAGGAATTACTCTCATTTTTTTATGCTGACAGTCGAATGTTGTTTTTTTCAAGCAGGAGATTGTTGCCTTATCTGGTGCACATACCCTAG
GAAGAGCCAGACCAGAACGTAGCGGTTGGGGAAAACCTGAGACAAAGTACACG
GTATATACATATTGAATAAACGACAAAACGTAAAGCTCTCTTATAATAGTGGTCGTAGCGATGACAG
TGTAGAGATCTTATGTAAACGTTCAAAACTGGCAGAAAACTGGACCTGGAGAAGCAGGGGGACAGTCTTGGACGGTGAAATGGCTTAAGTTTGACAATTCCTATTTCAAGGTCTACCTCT
CTATCTCTGTCTGTCTTAAGTAGCTTGGACTGGGGAATGAAGAAGAGTTTTTCAACAAGTTAATATATATGAATAAGATCCTCAGTTTCTTAGTTGTATGACTTGCAGGATATCAAAGAA
AAGAGGGACGAAGATCTTCTCGTGTTACCAACTGATGCTGCGCTATTTGAAGATCCTTCATTCAAG
GTTAACAAAACCAGTGATAAGATGCCACAGAACTAGTAGTTCCTACTCTCTTTT
TTTGACACTTTGTTTTTTGTACAGAACTATGCAGAGAAGTATGCTGAAGATCCGGCTGCATTTTTCAAGGATTACGCTGAAGCTCATGCCAAGCTCAGCAATCTCGGGGCTAAATTTGAT
CCTCCTGAG
GTACATCTTAAAGACAATAATCTTATCTCGAGCCACTAGTGTTAACTATGCGTTTTAAATCCAGTTCAGTGACTTAACCAACATTAAACATAGTCTAAAACTGCTAATGTT
GCTGTTAATCAGGGTATCATCATTGACAACGACCCTGCACAAGGAACTCCAGAGAAGTTCGTAGCCGCTAAGTATTCCACTGGAAAGGTTTGTCTTTAGTACACAAGAGAAAAAAGTGTT
TGTAGCTTACTGTAATATACATTTTTTGAGGAGATTGATTCTTTTTTTTCTAAATAGAAGGAGCTTTCGGAGTCAATGAAGAAGAAGATAAGAGCAGAGTATGAAGCAATTGGAGGAAGC
CCAAATAAGCCCTTACCCACTAATTACTTCCTCAACATCATTATCGCCATCAGCGTTTTGGTCCTCTTGTTCACTTTCTTTGGTAATAACAACTCCGATTACTCTGGTTTCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTTTCTCTCTCCGCCGCTTCTCACTCATCACTCTGCTCCTCCGCCTCCACCAAAGTCTCTCTTTCCCCCGCCGTCTCTTCCTCAGCCCCTCTCGTTGCTCTTTCTTCCTCTTCA
TCACAACCACATTCTTTCTCTTCTCTCCGAAGCGTCAAATCTTCCTCTCTATTTCCACATTTCTCCTTTACTCAG
AGAAAATATCCGATTAATGGGACGAAGAACAGAGGTTGTAGCACG
AAATGTGCCGCCTCTGATGCAGCTCAATTGAGAAGCGCTAAAGAAGATATCAAAGTTCTTCTCCGGACAAAGTTTTGCCATCCGATATTC
GTCAGGTTGGGATGGCACGATGCTGGCACA
TATAACAAGAACATCGAGGAGTGGCCACAGAGAGGTGGAGCTAATGGAAGTCTTAGATTTGAGGCTGAGCTTAAGCATGCTGCAAATGCTG
GTCTCATTAGTGCGTTAAATCTAATTCAG
CCTATCAAAGACAAGTATTCTAACATCTCTTACGCCGACTTATTCCAGTTAGCTAGTGCCACTGCAGTGGAG
GAGGCTGGTGGTCCTGAGATCCCGATGAAATATGGGAGAGTTGATGTC
TCGGTACCAGACCAATGTCCAGAAGAAGGAAGACTCCCTG
ATGCTGGACCGCCTTCACCAGCTGATCATTTGAGAGATGTATTCTACAGAATGGGACTCAATGATCAGGAGATTGTTGCC
TTATCTGGTGCACATACCCTAGGAAGAGCCAGACCAGAACGTAGCGGTTGGGGAAAACCTGAGACAAAGTACACG
AAAACTGGACCTGGAGAAGCAGGGGGACAGTCTTGGACGGTGAAA
TGGCTTAAGTTTGACAATTCCTATTTCAAG
GATATCAAAGAAAAGAGGGACGAAGATCTTCTCGTGTTACCAACTGATGCTGCGCTATTTGAAGATCCTTCATTCAAGAACTATGCAGAG
AAGTATGCTGAAGATCCGGCTGCATTTTTCAAGGATTACGCTGAAGCTCATGCCAAGCTCAGCAATCTCGGGGCTAAATTTGATCCTCCTGAG
GGTATCATCATTGACAACGACCCTGCA
CAAGGAACTCCAGAGAAGTTCGTAGCCGCTAAGTATTCCACTGGAAAG
AAGGAGCTTTCGGAGTCAATGAAGAAGAAGATAAGAGCAGAGTATGAAGCAATTGGAGGAAGCCCAAATAAG
CCCTTACCCACTAATTACTTCCTCAACATCATTATCGCCATCAGCGTTTTGGTCCTCTTGTTCACTTTCTTTGGTAATAACAACTCCGATTACTCTGGTTTCTAA

Retrieve as FASTA