Entry information : TsPrx[P]17-1 (Thhalv10000442m / ThPrx17-1)
Entry ID 9790
Creation 2011-11-18 (Qiang Li)
Last sequence changes 2014-02-04 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2015-10-22 (Christophe Dunand)
Peroxidase information: TsPrx[P]17-1 (Thhalv10000442m / ThPrx17-1)
Name (synonym) TsPrx[P]17-1 (Thhalv10000442m / ThPrx17-1)
Class Class III peroxidase     [Orthogroup: Prx019]*
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Eutrema
Organism Thellungiella salsuginea (Eutrema salsugineum)    [TaxId: 72664 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TsPrx[P]17-1
start..stop
S start..stop
CagraPrx51 501 0 1..276 47..323
CrubPrx17-1C 501 0 1..276 47..323
BstrPrx70 497 6e-180 1..277 46..323
ThasPrx65 473 2e-170 1..275 46..320
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2901370..2901435 66 N° 2 2901068..2901258 191 N° 3 2900299..2900873 575  
complement(join(2900299..2900873,2901068..2901258,2901370..2901435))


exon

Literature and cross-references TsPrx[P]17-1 (Thhalv10000442m / ThPrx17-1)
DNA ref. Phytozome 12:   scaffold_15 (2901435..2900299)
Protein sequence: TsPrx[P]17-1 (Thhalv10000442m / ThPrx17-1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   277
PWM (Da):   %s   30146.79  
PI (pH):   %s   5.2
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMREARSVASVMRFQFHDCFANGCDGSVLLDDTATLxGRKLSLSNIGSLRSFDVIDNIKEALEKACPATVPCADIIIMSARDAVALTGGPDWEVKLGRKDSLTASQKDSDDIMPSPRSNATSLINLFQRFNLSTKDMVALSGSHSIGEARCFSIMARLYNQSGSGKPDPAFEPIYREKLSMLCPMGGDENVTSGxDATAKVFDNQYFKDLVSRRGFLNSDQTLFTSPETSDYVTMFSENETEFLKAFAEGMVKMGDLQSTKPVEIRLNCRVVNRKNS

Retrieve as FASTA  
Remarks Partial sequence or pseudogene from genomic. Incorrect prediction from phytozome (Short 5' end is missing which is not found in genomic and frame shift). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GATGAGGGAAGCTCGAAGTGTTGCCTCCGTTATGCGTTTTCAATTCCATGATTGCTTTGCTAATGTAACTAATCACTAATTGATTTGGACTAACCACATTTCTGTAGATAATTATTGAAA
AAAAACTTAATAATGATATAATCCATCGTTTTGTTTTCCCTGGTTATTTTTGTAGGGATGTGATGGTTCTGTATTGCTGGATGACACAGCGACATTGTTNGGGAGAAAGCTCTCACTTTC
TAACATAGGCTCTTTGAGATCGTTCGATGTAATAGACAACATTAAGGAAGCATTAGAAAAGGCTTGTCCTGCCACGGTCCCTTGTGCAGACATCATAATCATGTCTGCTCGTGATGCAGT
TGCCCTAG
TAAGTTGCTCTCTCGATCATTTCCATATGCCGTTAGGCGTTAATCATTCTACATAGGATCAACCGTGTAAGGGTTGGACTAGACCGGTCTAATGATCGATCAGCCATGGTAA
TTTATACTGTATTTGTAAATTAGGTTTACTTCAATTTTGGATGATTAATTAATATGGGTTGGTATTTAAATTTGATACTAGACAGGAGGGCCGGACTGGGAAGTGAAGTTAGGGAGAAAA
GACAGTTTAACTGCAAGTCAAAAGGATTCAGACGACATCATGCCGAGTCCAAGATCAAACGCCACGAGTTTAATTAATCTCTTCCAAAGATTTAATCTCTCTACAAAAGACATGGTAGCT
CTATCTGGATCACACTCTATCGGCGAAGCTCGATGTTTCTCGATCATGGCTAGACTCTACAACCAATCTGGTTCAGGAAAACCCGACCCGGCTTTCGAGCCAATTTACCGAGAGAAATTG
AGCATGTTGTGTCCCATGGGAGGAGATGAAAACGTCACGAGTGGCAGNGACGCAACTGCTAAAGTGTTTGATAATCAATATTTCAAAGACTTGGTTTCTAGGAGAGGATTTCTTAATTCC
GATCAGACCTTGTTTACTTCTCCGGAGACGAGTGATTATGTGACAATGTTTAGTGAGAACGAAACGGAGTTTTTAAAGGCATTTGCGGAAGGGATGGTGAAGATGGGTGACTTGCAGTCT
ACGAAACCTGTAGAGATTAGATTAAATTGTCGAGTCGTTAATCGAAAGAACTCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GATGAGGGAAGCTCGAAGTGTTGCCTCCGTTATGCGTTTTCAATTCCATGATTGCTTTGCTAATGTATGTGATGGTTCTGTATTGCTGGATGACACAGCGACATTGTTNGGGAGAAAGCT
CTCACTTTCTAACATAGGCTCTTTGAGATCGTTCGATGTAATAGACAACATTAAGGAAGCATTAGAAAAGGCTTGTCCTGCCACGGTCCCTTGTGCAGACATCATAATCATGTCTGCTCG
TGATGCAGTTGCCCTAG
CAGGAGGGCCGGACTGGGAAGTGAAGTTAGGGAGAAAAGACAGTTTAACTGCAAGTCAAAAGGATTCAGACGACATCATGCCGAGTCCAAGATCAAACGCCAC
GAGTTTAATTAATCTCTTCCAAAGATTTAATCTCTCTACAAAAGACATGGTAGCTCTATCTGGATCACACTCTATCGGCGAAGCTCGATGTTTCTCGATCATGGCTAGACTCTACAACCA
ATCTGGTTCAGGAAAACCCGACCCGGCTTTCGAGCCAATTTACCGAGAGAAATTGAGCATGTTGTGTCCCATGGGAGGAGATGAAAACGTCACGAGTGGCAGNGACGCAACTGCTAAAGT
GTTTGATAATCAATATTTCAAAGACTTGGTTTCTAGGAGAGGATTTCTTAATTCCGATCAGACCTTGTTTACTTCTCCGGAGACGAGTGATTATGTGACAATGTTTAGTGAGAACGAAAC
GGAGTTTTTAAAGGCATTTGCGGAAGGGATGGTGAAGATGGGTGACTTGCAGTCTACGAAACCTGTAGAGATTAGATTAAATTGTCGAGTCGTTAATCGAAAGAACTCTTAA

Retrieve as FASTA