Entry information : TsPrx11 (Thhalv10018830m)
Entry ID 9792
Creation 2011-11-18 (Qiang Li)
Last sequence changes 2011-11-21 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-30 (Christophe Dunand)
Peroxidase information: TsPrx11 (Thhalv10018830m)
Name (synonym) TsPrx11 (Thhalv10018830m)
Class Class III peroxidase    [Orthogroup: Prx025]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Eutrema
Organism Thellungiella salsuginea (Eutrema salsugineum)    [TaxId: 72664 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TsPrx11
start..stop
S start..stop
BrPrx11-1Ab_other 662 0 1..335 1..335
AtPrx11 660 0 1..335 2..336
AlyPrx11 654 0 1..335 1..335
BrPrx11-1Ac_other 645 0 1..335 1..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5527915..5528136 222 N° 2 5528248..5528439 192 N° 3 5528546..5528711 166 N° 4 5529011..5529438 428
join(5527915..5528136,5528248..5528439,5528546..5528711,5529011..5529438)


exon

Literature and cross-references TsPrx11 (Thhalv10018830m)
DNA ref. Phytozome 12:   scaffold_9 (5527915..5529438)
Protein sequence: TsPrx11 (Thhalv10018830m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336 (316)
PWM (Da):   %s   37171.71 (34927.5)  
PI (pH):   %s   4.97 (4.78) Peptide Signal:   %s   cut: 20 range:20-335
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKLLLVIFIIHAIFGPCFSFDVPGKDLPLTLDYYKSTCPTVFDVIRKEMECIVKEDPRNAAILIRLHFHDCFVQGCDASVLLDETETLQGEKKASPNINSLKGYKIVDRIKNIIESECPGVVSCADLLTISARDATILVGGPYWDVPVGRKDSKTASYELATTNLPTPEEGLISIISKFYFQGLSVEDMVALIGAHTIGMAQCRNFRSRIYGDFQVTSALNPVSETYLASLREICPASSGEGDSNVTAIDNVTPNLFDNSIYHTLLRGEGLLNSDQEMYTSMFGIQTRRIVSKYAENPVAFFEQFSKSMVKMGNILNSESFVDGEVRKNCRFVNT*

Retrieve as FASTA  
Remarks Complete sequence fromm genomic (3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTCCTCCTTGTGATCTTTATCATCCACGCCATCTTTGGCCCCTGCTTTTCCTTTGATGTACCGGGAAAGGATCTTCCTCTTACCCTAGATTACTACAAGTCTACTTGCCCGACC
GTATTTGACGTTATCAGGAAAGAAATGGAATGCATAGTGAAGGAAGATCCTAGAAATGCAGCCATACTTATTCGTTTACACTTCCACGACTGCTTTGTCCAA
GTAAGCACTTATCCACAC
TTTTTGCTTGAAATACAAGAAATACAAGAAGTAAGTAAAGAAGTTTGCTTTGCCTTTATGGATGCTTACATAAGGGTTCAAATTGTATTGCAGGGGTGTGATGCATCGGTGTTGCTTGAC
GAAACAGAGACATTGCAGGGAGAGAAGAAAGCTTCTCCAAACATAAACTCATTGAAGGGATACAAAATTGTAGACAGAATCAAGAACATAATCGAATCCGAATGTCCTGGAGTTGTTTCT
TGCGCTGATCTTCTCACAATTTCTGCTAGAGATGCTACAATCCTG
GTACATATACTCTCTCACGTGGACGAATTATCATATTCAACATATTATATGGTATATACATGGATTATGAAATGT
AACAGCAAGTTAATCTTTGGTTTGATTAAAGGTTGGTGGACCTTACTGGGACGTTCCTGTGGGAAGAAAAGATTCAAAAACAGCAAGCTACGAGCTGGCGACAACGAACCTTCCAACTCC
TGAAGAGGGTTTAATCAGCATCATCTCTAAATTCTATTTTCAGGGTCTCTCTGTTGAAGACATGGTCGCCCTTATAG
GTAACATCAAACCTCTAAACCAAACCAAACCGGAAATTATAGT
AACTCAAAACCGGAAACTGATTTTGGTATCCTAACATCAAACCGATTGTTAAAATCCCTAAATCTGACCAAATCTATCTGATATTGAATGGAAGTATGGGACTACTAAAAAGGAAATGAA
AACCGGAAAACTGAATCAACATTTAAAACCAAAAGGAAAACCGGACAATTGATTTCGGTATTGTGTTAGGCCGGATAAGTTACGGTGGCATTAAACCGATCACTAAATCTCTTAAATTTA
CCAAAATCAATGGTAGGAGCTCACACGATCGGGATGGCACAGTGCCGGAACTTTCGATCGCGGATATACGGAGATTTTCAGGTGACGTCAGCACTTAATCCGGTGTCGGAGACGTATTTA
GCGAGCCTACGAGAGATTTGTCCGGCGAGCAGCGGAGAAGGTGACAGCAACGTGACGGCGATCGACAACGTGACGCCGAATCTCTTCGACAATTCGATCTACCACACGCTCCTGAGAGGC
GAAGGGTTGCTGAATTCGGACCAGGAGATGTACACGAGCATGTTCGGGATACAGACGCGGCGGATTGTGAGCAAGTACGCGGAGAATCCGGTGGCTTTCTTCGAGCAGTTCTCGAAGTCG
ATGGTGAAGATGGGGAATATTTTGAATTCCGAGAGTTTCGTCGATGGAGAAGTTAGAAAAAATTGCAGATTCGTGAATACATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTCCTCCTTGTGATCTTTATCATCCACGCCATCTTTGGCCCCTGCTTTTCCTTTGATGTACCGGGAAAGGATCTTCCTCTTACCCTAGATTACTACAAGTCTACTTGCCCGACC
GTATTTGACGTTATCAGGAAAGAAATGGAATGCATAGTGAAGGAAGATCCTAGAAATGCAGCCATACTTATTCGTTTACACTTCCACGACTGCTTTGTCCAA
GGGTGTGATGCATCGGTG
TTGCTTGACGAAACAGAGACATTGCAGGGAGAGAAGAAAGCTTCTCCAAACATAAACTCATTGAAGGGATACAAAATTGTAGACAGAATCAAGAACATAATCGAATCCGAATGTCCTGGA
GTTGTTTCTTGCGCTGATCTTCTCACAATTTCTGCTAGAGATGCTACAATCCTG
GTTGGTGGACCTTACTGGGACGTTCCTGTGGGAAGAAAAGATTCAAAAACAGCAAGCTACGAGCTG
GCGACAACGAACCTTCCAACTCCTGAAGAGGGTTTAATCAGCATCATCTCTAAATTCTATTTTCAGGGTCTCTCTGTTGAAGACATGGTCGCCCTTATAG
GAGCTCACACGATCGGGATG
GCACAGTGCCGGAACTTTCGATCGCGGATATACGGAGATTTTCAGGTGACGTCAGCACTTAATCCGGTGTCGGAGACGTATTTAGCGAGCCTACGAGAGATTTGTCCGGCGAGCAGCGGA
GAAGGTGACAGCAACGTGACGGCGATCGACAACGTGACGCCGAATCTCTTCGACAATTCGATCTACCACACGCTCCTGAGAGGCGAAGGGTTGCTGAATTCGGACCAGGAGATGTACACG
AGCATGTTCGGGATACAGACGCGGCGGATTGTGAGCAAGTACGCGGAGAATCCGGTGGCTTTCTTCGAGCAGTTCTCGAAGTCGATGGTGAAGATGGGGAATATTTTGAATTCCGAGAGT
TTCGTCGATGGAGAAGTTAGAAAAAATTGCAGATTCGTGAATACATGA

Retrieve as FASTA