Entry information : TsPrx13 (Thhalv10019514m)
Entry ID 9794
Creation 2011-11-18 (Qiang Li)
Last sequence changes 2011-11-21 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-30 (Christophe Dunand)
Peroxidase information: TsPrx13 (Thhalv10019514m)
Name (synonym) TsPrx13 (Thhalv10019514m)
Class Class III peroxidase    [Orthogroup: Prx016]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Eutrema
Organism Thellungiella salsuginea (Eutrema salsugineum)    [TaxId: 72664 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TsPrx13
start..stop
S start..stop
BstrPrx54 586 0 1..336 1..336
AhalPrx56 584 0 1..336 1..336
AlyPrx13 583 0 1..336 1..336
AtPrx13 577 0 1..336 1..336
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1545950..1546207 258 N° 2 1546335..1546520 186 N° 3 1546693..1546858 166 N° 4 1547012..1547412 401
join(1545950..1546207,1546335..1546520,1546693..1546858,1547012..1547412)


exon

Literature and cross-references TsPrx13 (Thhalv10019514m)
DNA ref. Phytozome 12:   scaffold_9 (1545950..1547412)
Protein sequence: TsPrx13 (Thhalv10019514m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   337
PWM (Da):   %s   36543.27 Transmb domain:   %s   i13-35o
PI (pH):   %s   5.22
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSRIVRESTSNNFFSPKMISAAIFIVLFFLHNQFSLSEAQLQFGFYSKTCPSAESIVRNAVQQSMTRDPGNAAVLLRLHFHDCFVEGCDGSILIKHEGNDDERFAGGNAGVGGFDVIDEAKSELERQCPGVVSCADIVALAARDAVAEAKGPFYEVPTGRRDGNTAKLSNAANLPDAQDSINILKSKFREKGLSDKDLVLLSAGAHTIGTTACFFVNPRLDAQDPTINPEFFQVLRSKCPQGGDVNVRIPLDWESQFVFDDQILQNIKNGKGVILSDSVLYQDNNMKKIIDSYLANNGSSKANFAVDFAEAMVKMGTIGVKVGVEGEIRHICNATN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCCGTATTGTACGAGAGAGTACATCAAATAATTTCTTTAGTCCGAAAATGATCAGTGCTGCAATATTTATAGTTTTGTTTTTTCTTCATAATCAATTCAGTCTCTCAGAGGCACAA
CTCCAATTTGGGTTCTACTCAAAAACATGTCCATCAGCAGAATCCATCGTCCGTAACGCTGTTCAACAGTCAATGACCCGCGACCCCGGAAATGCTGCTGTCTTACTCCGTCTCCATTTC
CACGATTGCTTTGTCGAG
GTCCATTCCAAAATCTAACATAAAATTAAGGACAATTTATTATCTATCTCTTCTCTTACACTTACATCATATGATGTTTTGTTCCGAGTTAGCTGACATAAT
TTGGTTTGGTTTATATATGTTGGAGGGTTGTGATGGGTCGATTCTAATAAAACACGAAGGAAATGATGACGAGAGATTTGCTGGGGGTAACGCTGGTGTGGGAGGTTTTGATGTTATAGA
CGAAGCCAAATCAGAGCTTGAACGTCAGTGTCCGGGCGTTGTGTCTTGCGCCGACATCGTTGCTCTTGCTGCTAGAGATGCTGTTGCTGAG
GTAACACTTGATTAGTTTCAACAAATTGA
GTCCTACTCATTTTATATTTGTCAAAAATTTGTCAAGAGGATTAAAATATAAAGGAAAAATTGGTGACTTCTTTTTATCCAAAATTGTATTATATAGTTTCTTGGTAAAGTATAAAACTC
TGATACTGAATATTATTAAACAGGCAAAAGGACCTTTTTACGAGGTTCCAACAGGACGAAGAGATGGTAACACTGCAAAGTTGAGTAACGCTGCGAACTTGCCAGATGCTCAAGATTCCA
TAAACATTTTGAAATCCAAATTCAGAGAAAAGGGGCTTTCAGATAAAGATCTTGTACTTCTTAGTGCTG
GTACTTCTAATAATCTCGACAACTTGATTAACTTTTTTTCATTTGTTTAAA
TAACTAGGAGGTTTATGATCGAAATCTGTATATATTTCCTCAAGCCAAAGATTGTATAGTATAATCCTTCCCGTTTATAATTAATTTTATTCATGTTTATAGGTGCACATACTATTGGCA
CAACAGCGTGTTTCTTCGTTAACCCACGTTTAGATGCTCAAGACCCCACGATAAACCCAGAGTTCTTCCAAGTGTTGAGGTCAAAGTGTCCACAAGGTGGTGATGTTAATGTCAGAATTC
CGTTGGATTGGGAAAGCCAGTTTGTGTTCGACGACCAAATCTTGCAGAACATCAAAAATGGCAAAGGAGTCATTCTATCAGACTCTGTTTTGTATCAAGACAATAATATGAAGAAAATCA
TTGATTCATATTTGGCCAATAACGGGAGTTCGAAAGCGAATTTTGCTGTGGATTTTGCTGAAGCCATGGTAAAGATGGGTACCATTGGGGTGAAGGTCGGTGTTGAAGGAGAGATCAGAC
ACATATGCAATGCTACAAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCCGTATTGTACGAGAGAGTACATCAAATAATTTCTTTAGTCCGAAAATGATCAGTGCTGCAATATTTATAGTTTTGTTTTTTCTTCATAATCAATTCAGTCTCTCAGAGGCACAA
CTCCAATTTGGGTTCTACTCAAAAACATGTCCATCAGCAGAATCCATCGTCCGTAACGCTGTTCAACAGTCAATGACCCGCGACCCCGGAAATGCTGCTGTCTTACTCCGTCTCCATTTC
CACGATTGCTTTGTCGAG
GGTTGTGATGGGTCGATTCTAATAAAACACGAAGGAAATGATGACGAGAGATTTGCTGGGGGTAACGCTGGTGTGGGAGGTTTTGATGTTATAGACGAAGCC
AAATCAGAGCTTGAACGTCAGTGTCCGGGCGTTGTGTCTTGCGCCGACATCGTTGCTCTTGCTGCTAGAGATGCTGTTGCTGAG
GCAAAAGGACCTTTTTACGAGGTTCCAACAGGACGA
AGAGATGGTAACACTGCAAAGTTGAGTAACGCTGCGAACTTGCCAGATGCTCAAGATTCCATAAACATTTTGAAATCCAAATTCAGAGAAAAGGGGCTTTCAGATAAAGATCTTGTACTT
CTTAGTGCTG
GTGCACATACTATTGGCACAACAGCGTGTTTCTTCGTTAACCCACGTTTAGATGCTCAAGACCCCACGATAAACCCAGAGTTCTTCCAAGTGTTGAGGTCAAAGTGTCCA
CAAGGTGGTGATGTTAATGTCAGAATTCCGTTGGATTGGGAAAGCCAGTTTGTGTTCGACGACCAAATCTTGCAGAACATCAAAAATGGCAAAGGAGTCATTCTATCAGACTCTGTTTTG
TATCAAGACAATAATATGAAGAAAATCATTGATTCATATTTGGCCAATAACGGGAGTTCGAAAGCGAATTTTGCTGTGGATTTTGCTGAAGCCATGGTAAAGATGGGTACCATTGGGGTG
AAGGTCGGTGTTGAAGGAGAGATCAGACACATATGCAATGCTACAAATTAG

Retrieve as FASTA