Entry information : TsPrx30 (Thhalv10021123m)
Entry ID 9796
Creation 2011-11-18 (Qiang Li)
Last sequence changes 2011-11-21 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-30 (Christophe Dunand)
Peroxidase information: TsPrx30 (Thhalv10021123m)
Name (synonym) TsPrx30 (Thhalv10021123m)
Class Class III peroxidase    [Orthogroup: Prx008]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Eutrema
Organism Thellungiella salsuginea (Eutrema salsugineum)    [TaxId: 72664 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TsPrx30
start..stop
S start..stop
CrubPrx66 625 0 8..328 6..326
CagraPrx41 624 0 8..328 6..326
BstrPrx02 624 0 8..328 9..329
AlyPrx30 623 0 1..328 4..329
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1373108..1373326 219 N° 2 1372542..1372730 189 N° 3 1372279..1372441 163 N° 4 1371778..1372193 416
complement(join(1371778..1372193,1372279..1372441,1372542..1372730,1373108..1373 326))


exon

Literature and cross-references TsPrx30 (Thhalv10021123m)
Literature Taji,T., Sakurai,T., Mochida,K., Ishiwata,A., Kurotani,A., Totoki,Y., Toyoda,A., Sakaki,Y., Seki,M., Ono,H., Sakata,Y., Tanaka,S. and Shinozaki,K. BMC Plant Biol. 8, 115 (2008).
DNA ref. Phytozome 12:   scaffold_13 (1373326..1371778)
EST ref. GenBank:   BAJ34038
Protein sequence: TsPrx30 (Thhalv10021123m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (302)
PWM (Da):   %s   35419.09 (32758.7) Transmb domain:   %s   i5-22o
PI (pH):   %s   9.74 (9.75) Peptide Signal:   %s   cut: 27 range:27-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKQGIVMVVVAVAATVLMGMLGSSEAQLQMNFYAKSCPNAEKIISDHIEKHIHNGPSLAAPLIRMHFHDCFVRGCDGSVLINSTTGNAEKDAPPNLTLRGFGFVERIKTLLEAVCPKTVSCADIIALTARDAVVATGGPSWSVPTGRRDGRISNSTEALNNIPPPTSNFTTLQRLFANQGLNLKDLVLLSGAHTIGVSHCSSMNSRLYNFSTTVKQDPALDSEYATNLKANKCKSLNDNTTILEMDPGSARSFDLSYYRLVLKRRGLFQSDSALTTNSATLKMINDLVNGSEKKFYKAFAKSMEKMGRVKVKTGSTGVIRTRCSVAGS*

Retrieve as FASTA  
Remarks Complete sequence fromm genomic (3 introns) and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCAAGGGATTGTTATGGTTGTGGTTGCGGTTGCAGCCACGGTTCTTATGGGAATGTTAGGATCATCCGAGGCTCAGCTTCAAATGAATTTCTACGCAAAGAGCTGTCCAAATGCC
GAGAAAATAATTTCAGATCATATTGAAAAGCATATCCATAATGGTCCTTCTCTTGCTGCTCCTCTCATCAGGATGCACTTCCACGATTGCTTTGTCAGG
GTATTTATTTAATTTGGTCTC
ATTAATTTTAGATTTTTGTTCGTATATTATGTACATATGTATTAATTATTATTCACACGTTAATATCCACACACATCCAGTTCAATAGATTACTCATAATGATGAGATAATCTTTTTTTT
TTGGATGAGTGTTAAATTGTATTCAAACCAAAAAAAAAAAAAAACGTTTACATCTGTGATGCGATCTTTTAAACTGGTATTGACAATGAGATAATCGACAAGATGTACTGTATTATATCA
AATAAATTAAAAAATGGTAATTTGATAGTAGTAAATTCGAGCTAGAGCATAATTTTTGAGATTTTTTTTGTTTAATGTTGACAATTGATTTTGGAAAAAAAAATTAATAAATGAAGGGAT
GCGATGGATCAGTGTTGATAAATTCGACAACTGGGAACGCAGAGAAAGATGCACCACCGAATCTAACACTAAGAGGATTCGGTTTCGTAGAGAGGATTAAGACTCTTCTTGAAGCAGTGT
GTCCTAAGACTGTTTCTTGCGCCGATATCATCGCTTTGACCGCTAGAGATGCAGTTGTTGCCACC
GTAAGTAATCAAACTATATATAAAAAAAAAAAAGAAAAAGATTTAGCGGCTCACT
TTTGTAAACCTAAACAAAATGTGACCCTTGAAAACTTTCCGACAGGGAGGTCCTTCGTGGAGTGTTCCGACCGGAAGAAGAGACGGTAGGATCTCAAACTCAACAGAGGCTTTGAACAAC
ATTCCACCTCCGACAAGTAATTTCACGACGTTACAACGACTTTTCGCTAACCAAGGCCTTAATCTCAAAGACCTTGTCCTCCTCTCCG
GTAATTTACTAGGAAATACTAAATTACATGTA
ACCGTTCATTTAAGGTTGGTTTGTCAAACTTTTAACTCTCTTTGAATTTTCAGGGGCTCACACGATCGGTGTCTCGCATTGTTCTTCAATGAATTCTCGTCTCTACAACTTCTCGACGAC
AGTCAAACAAGATCCAGCTCTGGACAGCGAATACGCAACGAATCTAAAGGCCAACAAATGTAAAAGCCTCAACGACAACACCACCATCCTCGAGATGGATCCAGGTAGCGCCAGAAGTTT
CGATCTTAGTTATTACAGGCTTGTCCTGAAGAGGAGAGGTCTGTTTCAGTCTGATTCTGCACTGACGACCAACTCAGCGACGTTGAAGATGATCAACGACTTGGTCAACGGTTCCGAAAA
GAAGTTTTACAAGGCTTTCGCTAAGTCGATGGAGAAGATGGGAAGGGTTAAAGTGAAGACGGGCTCAACCGGCGTAATCAGGACAAGATGTTCTGTCGCCGGAAGTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCAAGGGATTGTTATGGTTGTGGTTGCGGTTGCAGCCACGGTTCTTATGGGAATGTTAGGATCATCCGAGGCTCAGCTTCAAATGAATTTCTACGCAAAGAGCTGTCCAAATGCC
GAGAAAATAATTTCAGATCATATTGAAAAGCATATCCATAATGGTCCTTCTCTTGCTGCTCCTCTCATCAGGATGCACTTCCACGATTGCTTTGTCAGG
GGATGCGATGGATCAGTGTTG
ATAAATTCGACAACTGGGAACGCAGAGAAAGATGCACCACCGAATCTAACACTAAGAGGATTCGGTTTCGTAGAGAGGATTAAGACTCTTCTTGAAGCAGTGTGTCCTAAGACTGTTTCT
TGCGCCGATATCATCGCTTTGACCGCTAGAGATGCAGTTGTTGCCACC
GGAGGTCCTTCGTGGAGTGTTCCGACCGGAAGAAGAGACGGTAGGATCTCAAACTCAACAGAGGCTTTGAAC
AACATTCCACCTCCGACAAGTAATTTCACGACGTTACAACGACTTTTCGCTAACCAAGGCCTTAATCTCAAAGACCTTGTCCTCCTCTCCG
GGGCTCACACGATCGGTGTCTCGCATTGT
TCTTCAATGAATTCTCGTCTCTACAACTTCTCGACGACAGTCAAACAAGATCCAGCTCTGGACAGCGAATACGCAACGAATCTAAAGGCCAACAAATGTAAAAGCCTCAACGACAACACC
ACCATCCTCGAGATGGATCCAGGTAGCGCCAGAAGTTTCGATCTTAGTTATTACAGGCTTGTCCTGAAGAGGAGAGGTCTGTTTCAGTCTGATTCTGCACTGACGACCAACTCAGCGACG
TTGAAGATGATCAACGACTTGGTCAACGGTTCCGAAAAGAAGTTTTACAAGGCTTTCGCTAAGTCGATGGAGAAGATGGGAAGGGTTAAAGTGAAGACGGGCTCAACCGGCGTAATCAGG
ACAAGATGTTCTGTCGCCGGAAGTTAA

Retrieve as FASTA