Entry information : TsPrx15 (Thhalv10022774m)
Entry ID 9802
Creation 2011-11-18 (Qiang Li)
Last sequence changes 2011-11-21 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-30 (Christophe Dunand)
Peroxidase information: TsPrx15 (Thhalv10022774m)
Name (synonym) TsPrx15 (Thhalv10022774m)
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Eutrema
Organism Thellungiella salsuginea (Eutrema salsugineum)    [TaxId: 72664 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TsPrx15
start..stop
S start..stop
AruPrx15 633 0 1..336 1..335
AtPrx15 629 0 1..335 1..336
BrPrx15-1Ac_other 626 0 1..336 1..336
AhalPrx05 624 0 1..335 1..337
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 948170..948409 240 N° 2 948504..948695 192 N° 3 948776..948941 166 N° 4 949034..949446 413
join(948170..948409,948504..948695,948776..948941,949034..949446)


exon

Literature and cross-references TsPrx15 (Thhalv10022774m)
DNA ref. Phytozome 12:   scaffold_11 (948170..949446)
Protein sequence: TsPrx15 (Thhalv10022774m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   337 (314)
PWM (Da):   %s   36179.53 (33864.3)  
PI (pH):   %s   4.82 (4.73) Peptide Signal:   %s   cut: 23 range:23-336
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARIGSLLVLLSLACSLTLCIGDDESNYGGNRGNLSPGFYSSSCPKAEEIVKSVVAQAVARETRMAASLMRLHFHDCFVQGCDGSLLLDTSGSIVTEKSSNPNSRSARGFEVVDQIKAALENECPGTVSCADVLTLAARDSSVLTGGPSWMVPLGRRDSTTASLSGSNNNIPAPNNTFNTILSRFTNQGLDLTDLVALSGSHTIGFSRCTSFRQRLYNQSGNGSPDSTLEQSYAANLRQMCPRSGGDQNLSELDINSAGRFDNSYFKNLIENMGLLNSDQVLFSSNEESSELVKKYAEDQEEFFEQFAESMVKMGNISPLTGSSGEIRKNCRKVNS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAGAATCGGAAGCCTTCTCGTTCTTCTCTCTCTCGCTTGCTCTCTTACTCTCTGCATCGGGGACGACGAGAGTAATTATGGTGGTAATAGAGGGAACCTTTCCCCAGGTTTCTAC
AGCAGCTCGTGCCCTAAAGCCGAGGAGATCGTGAAGTCAGTTGTAGCCCAAGCTGTTGCAAGAGAGACTCGTATGGCTGCTTCTCTCATGAGGCTCCACTTCCACGATTGTTTTGTTCAG
GTACTCAATGATTTTTTTTTTAAGTTACTTTCTCAACAAGCTAACGATTAATGTAGAGAATCATCATTGTATCTATTTGAATGAAAATGTGTAGGGTTGTGATGGCTCGTTGCTTTTAGA
CACCAGTGGGAGTATAGTTACTGAGAAAAGCTCTAACCCTAACAGCAGATCGGCTCGCGGGTTTGAGGTTGTCGACCAGATCAAAGCTGCGTTAGAGAATGAATGCCCTGGAACTGTTTC
TTGCGCTGACGTCTTAACTCTGGCCGCTAGAGACTCATCTGTTCTT
GTAAGTTGATTTCTTTCTTTCTCTCTCTTGCATGCTTATTTAAGTTCTCAAGATCTAAATTGGTTTCGGTTTGA
GTGTAGACTGGCGGACCAAGCTGGATGGTTCCTTTGGGAAGAAGAGATTCGACAACTGCCAGCTTGAGTGGCTCAAATAACAACATTCCTGCACCAAACAACACTTTCAACACAATTCTC
TCCAGATTTACTAATCAGGGTCTTGATCTAACCGACCTCGTTGCTCTCTCCG
GTAAGCTTACTTTACACACAAGGAAGAGATATGGTGATGGTTACTTTACTTGCTTCTCAAGCTGACGT
TAAACCCTAATATGTCTTTGTCAGGGAGTCACACCATTGGATTCTCAAGATGCACGAGTTTCAGGCAAAGACTTTACAACCAATCCGGAAACGGAAGTCCCGACTCCACCTTAGAGCAAT
CCTACGCTGCTAACTTGCGCCAGATGTGTCCTAGATCAGGTGGGGACCAGAACCTGTCGGAGCTTGACATCAACAGTGCCGGGAGGTTTGATAACAGCTACTTCAAGAACTTGATCGAGA
ACATGGGACTTTTGAATTCCGACCAGGTCTTGTTCTCTAGTAACGAGGAATCGAGTGAGCTTGTGAAGAAGTATGCAGAGGATCAAGAAGAGTTCTTCGAGCAGTTCGCGGAATCGATGG
TCAAGATGGGGAATATCTCTCCCTTGACAGGTTCAAGTGGTGAGATCAGGAAGAACTGTAGGAAGGTTAACTCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAGAATCGGAAGCCTTCTCGTTCTTCTCTCTCTCGCTTGCTCTCTTACTCTCTGCATCGGGGACGACGAGAGTAATTATGGTGGTAATAGAGGGAACCTTTCCCCAGGTTTCTAC
AGCAGCTCGTGCCCTAAAGCCGAGGAGATCGTGAAGTCAGTTGTAGCCCAAGCTGTTGCAAGAGAGACTCGTATGGCTGCTTCTCTCATGAGGCTCCACTTCCACGATTGTTTTGTTCAG
GGTTGTGATGGCTCGTTGCTTTTAGACACCAGTGGGAGTATAGTTACTGAGAAAAGCTCTAACCCTAACAGCAGATCGGCTCGCGGGTTTGAGGTTGTCGACCAGATCAAAGCTGCGTTA
GAGAATGAATGCCCTGGAACTGTTTCTTGCGCTGACGTCTTAACTCTGGCCGCTAGAGACTCATCTGTTCTT
ACTGGCGGACCAAGCTGGATGGTTCCTTTGGGAAGAAGAGATTCGACA
ACTGCCAGCTTGAGTGGCTCAAATAACAACATTCCTGCACCAAACAACACTTTCAACACAATTCTCTCCAGATTTACTAATCAGGGTCTTGATCTAACCGACCTCGTTGCTCTCTCCG
GG
AGTCACACCATTGGATTCTCAAGATGCACGAGTTTCAGGCAAAGACTTTACAACCAATCCGGAAACGGAAGTCCCGACTCCACCTTAGAGCAATCCTACGCTGCTAACTTGCGCCAGATG
TGTCCTAGATCAGGTGGGGACCAGAACCTGTCGGAGCTTGACATCAACAGTGCCGGGAGGTTTGATAACAGCTACTTCAAGAACTTGATCGAGAACATGGGACTTTTGAATTCCGACCAG
GTCTTGTTCTCTAGTAACGAGGAATCGAGTGAGCTTGTGAAGAAGTATGCAGAGGATCAAGAAGAGTTCTTCGAGCAGTTCGCGGAATCGATGGTCAAGATGGGGAATATCTCTCCCTTG
ACAGGTTCAAGTGGTGAGATCAGGAAGAACTGTAGGAAGGTTAACTCTTGA

Retrieve as FASTA