Entry information : TsAPx23-2 (Thhalv10022797m / ThAPx23-2)
Entry ID 9803
Creation 2011-11-18 (Qiang Li)
Last sequence changes 2011-11-21 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-31 (Christophe Dunand)
Peroxidase information: TsAPx23-2 (Thhalv10022797m / ThAPx23-2)
Name (synonym) TsAPx23-2 (Thhalv10022797m / ThAPx23-2)
Class Ascorbate peroxidase    [Orthogroup: APx011]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Eutrema
Organism Thellungiella salsuginea (Eutrema salsugineum)    [TaxId: 72664 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TsAPx23-2
start..stop
S start..stop
AlyAPx23-2 526 0 2..288 4..292
CrubAPx03-2 521 0 2..288 3..290
BnAPx03-1Aa_other 491 3e-178 1..288 1..287
CrubAPx03-1 490 1e-177 1..288 1..287
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2883251..2883363 113 N° 2 2883544..2883668 125 N° 3 2883989..2884038 50 N° 4 2884707..2884772 66
N° 5 2884864..2884912 49 N° 6 2885110..2885192 83 N° 7 2885282..2885361 80 N° 8 2885472..2885577 106
N° 9 2885737..2885931 195  
join(2883251..2883363,2883544..2883668,2883989..2884038,2884707..2884772,2884864 ..2884912,2885110..2885192,2885282..2885361,2885472..2885577,2885737..2885931)


exon

Literature and cross-references TsAPx23-2 (Thhalv10022797m / ThAPx23-2)
DNA ref. Phytozome 12:   scaffold_11 (2883251..2885931)
Protein sequence: TsAPx23-2 (Thhalv10022797m / ThAPx23-2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   289
PWM (Da):   %s   31798.18 Transmb domain:   %s   o259-281i
PI (pH):   %s   5.89
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAALVVDAEYLKEVEKARRELRSLIAKKNCAPIMLRLAWHDAGTYDAKSKTGGPNGSIRNETEYSHGANSGLKIALDLCEDVKSKLPKISYADLYQLAGVVAVEVTGGPDISFVPGRKDCNDCTDEGRLPDANQGFKHLKDVFYRMGLSDKDIVALSGAHTLGRAHPERSGFDGPWTQDPLKFDNSYFVELLKEEESEGLLKLSTDKTLLEVPEFRHYVELYAKDEDAFFRDYAESHKKLSELGFTPTSSIAKAITDSTVLAHSAVGVAVAAAVVAFGYFYEIRRKMK*

Retrieve as FASTA  
Remarks Complete sequence from genomic. No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCACTCGTAGTTGACGCGGAGTACCTTAAGGAGGTCGAAAAGGCTCGCCGTGAGCTTCGTTCGCTCATCGCTAAGAAGAATTGCGCTCCGATCATGCTCCGATTGGCGTAAGTT
TTCATTTCTGTCGTTTTCTTTTTGGCGATTCCCTCGTATTGAGTGCTATGAGGTCTCTTTTCCTGGGAAATTTGAGGAATCTCGCGCTGCTTTGGAATTTTGTTTGCTTTCATGTGCGAT
TTCTGGTTCTTTGCTTTGGTTCACTTGTTGTCGTCTTCTCTGGTTTGTGAAAGGTGGCATGATGCTGGAACCTACGACGCCAAATCGAAGACCGGTGGACCTAATGGATCGATTAGGAAC
GAAACGGAGTACAGTCATGGTGCTAATAGTGGTTTGAAAATCGCTCTCGATCTCTGTG
GTACGTTTCTCCTTTCGCTTCTTTATGGAGTTTAGATACAGTGACCTTTAGATGATTATGTG
TTGGCTATGGTTTGACCTGGATTATACAGATTTACTTGTAATGAGATCGTTCTATACTTCTATTAGTAGTCCTGAGGATTTATGAGAAGTTTACATGTTAAACCTGTTAGTGTGTGTCTT
ATATGCTTATCAGTTTTAGAGACCTTTGCCTTGTATTCATGTGCTTGTATTATGGTGTCTTATGAGTTACGAATGAAATTTTCAAGAACAGTCTTACTTTTTCTTTTGGAATTTGATGTT
GATTCTTTGATATTTCAGAGGACGTGAAATCTAAACTTCCCAAGATCAGTTATGCGGACCTATACCAGGTAAACTTAAACGAATTTTGACTTGAAGTTTTATGATAACATAAAGGTTCCT
ACTGGATTTTAAGACAATAAAACAAAGGCTCGTTTTGTCCAGTTGTGTTGGCTCTATAATTTCCCATCTTGTTTTTTTGTGCTCTTTCTTCGGATTGTCCTGTGACTTTTTACAAGTTGT
TAATCATAAACTCATCAAAAGTGTTTTTAGATCTATTTGGCTGATCGTTGTATGATTGTTGTCCTCAGGGTATAGAAACAGGAAATTGACAATTGTGCTTTGTGGTTAATATCTTTGGCA
TATTTGCAATTTGAAGAATTTTCACACTCACACACATGAACAGTAATAGTTTTCTGGTCTCTTGCTTTCACAATTGTTCTTTTAAGTAAAGTATATTGATGGTGTCTCAATTATCGAGGA
AGCTTAACAAAAACAGTCAAAACCATTTCCGTGGTAGCCTGCATGGAAATACACTTCACCAAGGACCACAAATGAAAAAAGTGCCACTTTATCTTTGACTGTGAATTTGTGAAAAGAATC
CTGAATATAGCATTGTCAATAAGGCATGTAAACATTTCTGTTGTTTGCCTTTAACTATTCACTCATCAATGCTATTCTATCCTGGAATTTACAGACCTTACATTTTCGCTCGAAATTGAT
TCTGTCATATTTTCAGCTTGCTGGCGTGGTAGCGGTTGAAGTTACTGGTGGACCTGACATCAGTTTTGTTCCTGGAAGAAAAGTAATATTTTCTCAGCTACTAAGATGAATGGTATTACA
GTTTACCGCCAAATACAATTTAACTATATTACTTGTATGTTTCTCTCTTATAGGATTGTAATGACTGCACCGACGAAGGAAGACTTCCTGATGCTAATCAAGGTAGGATGATTTTTTTTT
CCCAATTATTACAAACACCAAAGTGAATTACTTAAATGAAAGACCCCTAATGTACTTAGTATCTGAGGAGCAAATAAATAATGGAAGATGATCGCATATAGTACTTGGTGTTGCCCCATG
TACAGTATATTCTTTCCACTATGAGTGTTTGAAGTTATGTCTGCTAATTTTGCATTTAGGTTTCAAACATCTTAAAGATGTTTTCTACCGAATGGGACTGTCTGATAAAGATATTGTGGC
ACTCTCAGGGGCTCATACTCTG
GTAAATTCTTTGTTTCACAATTCACATTTGTCGTTTAGTATTAAATAAACATAGCTGTGTTGGGGTCTTAATAAAATTCTGATGTTTAGGGAAGGGCT
CATCCAGAGAGATCAGGTTTCGATGGACCATGGACTCAAGATCCTCTCAAGTTTGATAACTCATACTTTGT
GTAAGATCATCTTAAGTCATGGACAGTTTTTTTTTTTTTGTTGTTGAGG
ACTACAAATAGTTGTTCTCACTTCTCACTGATTACTGGACTTTGATCACTGTTGGTAAAAGGGAATTACTGAAGGAAGAAGAATCCGAGGGCTTGCTGAAACTTTCGACAGACAAGACTT
TGTTGGAAGTCCCAGAGTTCCGTCACTACGTTGAGCTTTATGCAAAG
GTATTGTCTTCATTGTGATCCAAATATCCGAGTGAATTATTACTCTAGACCTGCAAACCGATCGAGTTTCATA
TAGACTGGCCAAGATTATGTTGTAAAGTGTCATCTTGGCTTCTTCTTTTGTTTAACCATTTTGTTTCTAATGTTTTGTACCAACAGGACGAAGATGCATTCTTCAGAGACTATGCGGAGT
CACACAAGAAACTTTCAGAGCTCGGGTTCACACCGACGTCTTCCATCGCTAAGGCAATAACAGATAGCACCGTGCTCGCACATAGTGCAGTCGGAGTCGCGGTCGCTGCTGCTGTTGTGG
CCTTTGGCTACTTCTATGAAATTCGCAGGAAGATGAAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCACTCGTAGTTGACGCGGAGTACCTTAAGGAGGTCGAAAAGGCTCGCCGTGAGCTTCGTTCGCTCATCGCTAAGAAGAATTGCGCTCCGATCATGCTCCGATTGGCGTGGCAT
GATGCTGGAACCTACGACGCCAAATCGAAGACCGGTGGACCTAATGGATCGATTAGGAACGAAACGGAGTACAGTCATGGTGCTAATAGTGGTTTGAAAATCGCTCTCGATCTCTGTG
AG
GACGTGAAATCTAAACTTCCCAAGATCAGTTATGCGGACCTATACCAG
CTTGCTGGCGTGGTAGCGGTTGAAGTTACTGGTGGACCTGACATCAGTTTTGTTCCTGGAAGAAAAGATTGT
AATGACTGCACCGACGAAGGAAGACTTCCTGATGCTAATCAAG
GTTTCAAACATCTTAAAGATGTTTTCTACCGAATGGGACTGTCTGATAAAGATATTGTGGCACTCTCAGGGGCTCAT
ACTCTG
GGAAGGGCTCATCCAGAGAGATCAGGTTTCGATGGACCATGGACTCAAGATCCTCTCAAGTTTGATAACTCATACTTTGTGGAATTACTGAAGGAAGAAGAATCCGAGGGCTTG
CTGAAACTTTCGACAGACAAGACTTTGTTGGAAGTCCCAGAGTTCCGTCACTACGTTGAGCTTTATGCAAAG
GACGAAGATGCATTCTTCAGAGACTATGCGGAGTCACACAAGAAACTT
TCAGAGCTCGGGTTCACACCGACGTCTTCCATCGCTAAGGCAATAACAGATAGCACCGTGCTCGCACATAGTGCAGTCGGAGTCGCGGTCGCTGCTGCTGTTGTGGCCTTTGGCTACTTC
TATGAAATTCGCAGGAAGATGAAGTAA

Retrieve as FASTA