Entry information : TsPrx39 (Thhalv10028797m)
Entry ID 9805
Creation 2011-11-18 (Qiang Li)
Last sequence changes 2011-11-21 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-31 (Christophe Dunand)
Peroxidase information: TsPrx39 (Thhalv10028797m)
Name (synonym) TsPrx39 (Thhalv10028797m)
Class Class III peroxidase    [Orthogroup: Prx009]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Eutrema
Organism Thellungiella salsuginea (Eutrema salsugineum)    [TaxId: 72664 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TsPrx39
start..stop
S start..stop
BrPrx39-1A_other 611 0 1..326 1..326
CrubPrx89 600 0 1..326 1..326
BstrPrx83 598 0 1..326 1..326
AtPrx39 597 0 1..326 1..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4721645..4721854 210 N° 2 4721199..4721393 195 N° 3 4720943..4721105 163 N° 4 4720413..4720825 413
complement(join(4720413..4720825,4720943..4721105,4721199..4721393,4721645..4721 854))


exon

Literature and cross-references TsPrx39 (Thhalv10028797m)
DNA ref. Phytozome 12:   scaffold_3 (4721854..4720413)
Protein sequence: TsPrx39 (Thhalv10028797m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (303)
PWM (Da):   %s   35444.11 (32818.7)  
PI (pH):   %s   8.21 (8.21) Peptide Signal:   %s   cut: 24 range:24-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARFVLVFVTILVILGSMSFSEAQLKIGFYDKTCPNAEKIVQNLVNQHIGNVPSLAAGLIRMHFHDCFVRGCDGSILINATSRNQQVEKVSPPNLTVRGFDFIDLVKKVLESKCPGIVSCADIITLATRDSVAAIGGPTWSVPTGRRDGRISNANESLNNIPPPFGNFTTLITLFGNQGLDVKDLVLLSGAHTIGVSHCSSFSNRLFNFTGVGDQDPSLDSEYADNLKARRCLSLADNTTKVEMDPGSRNTFDLSYFRLVLKRRGLFESDAALTMNSAALALVRRFAGGSEQDFFVEFGKSMEKMGRIGVKTGSDGEIRRTCAVVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGATTCGTTTTAGTTTTCGTGACGATTCTTGTGATTCTAGGGTCTATGAGCTTTTCAGAAGCACAATTGAAGATAGGGTTCTACGACAAAACTTGCCCTAACGCAGAGAAGATA
GTACAAAATCTTGTCAACCAACATATCGGCAACGTACCCTCTTTGGCTGCTGGTCTTATTAGGATGCATTTCCATGATTGCTTCGTTCGG
GTATTAATCTTCATTTTTGTTTTTATCATA
ATTCATAAATATAAATTCCATACTAGCTTCTCAAATTGCTTGCATATTACTCAGTATGTAGATTATAAGTCTGAAAACCACTACAATAATAGAAAATAAAAGTTGAGTTAGTATCATCAA
ATAAGTTATTTTAAAGCATACATTAAACATAACATTTAATTATTCATATATACGTATGATATAAAAATACGTAACTGATTATATGTATTTGGTGTTGGTAGGGTTGTGATGGTTCGATCT
TGATCAACGCGACATCAAGAAACCAACAAGTGGAGAAGGTATCTCCACCGAATCTAACTGTTAGAGGTTTCGACTTTATCGATCTAGTGAAGAAAGTTCTCGAATCCAAGTGTCCAGGAA
TAGTCTCATGTGCCGATATCATCACTCTCGCTACTAGAGACTCTGTTGCTGCCATT
GTAAGTCTGCTAACAATATTTGTCACCTCGATAAATCTAATTTATAACCCACTGATACCAAAAC
AAACCGGTCTTGGTTACATTTTTGTTTAGGGTGGACCAACATGGAGTGTTCCTACAGGACGCAGAGACGGACGTATCTCTAATGCTAACGAGTCTTTGAATAATATCCCTCCTCCTTTTG
GAAACTTCACGACTCTTATAACTCTCTTTGGAAACCAAGGACTTGATGTTAAGGACCTAGTCTTGTTATCCG
GTAAGAAAATTGAATTCTTCCGGTTCGGTTTAGTAATTTTATAAAATT
ATGGTTGAACCAAAGCCATAGAACAAAACGGTGCCGTTTGATTCAAAATGAGTTCATTTAACGTTTTAGGTGCGCATACTATTGGAGTGTCTCATTGCTCCTCCTTCTCGAACCGTCTTT
TCAACTTTACTGGCGTCGGAGATCAAGATCCATCGCTCGACAGTGAATACGCAGACAATCTCAAAGCAAGAAGATGTTTGTCTCTCGCCGACAATACCACAAAGGTCGAAATGGATCCTG
GTAGTCGAAACACCTTCGATCTTAGTTACTTTAGGCTAGTCTTGAAACGTCGTGGACTTTTTGAGTCTGACGCGGCGTTGACTATGAATTCGGCTGCGTTGGCTCTGGTTAGACGCTTTG
CTGGAGGATCTGAGCAAGATTTCTTCGTTGAGTTCGGAAAGTCGATGGAGAAAATGGGAAGGATTGGTGTAAAAACCGGGTCGGATGGGGAAATTCGAAGAACCTGTGCAGTGGTTAATT
AA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGATTCGTTTTAGTTTTCGTGACGATTCTTGTGATTCTAGGGTCTATGAGCTTTTCAGAAGCACAATTGAAGATAGGGTTCTACGACAAAACTTGCCCTAACGCAGAGAAGATA
GTACAAAATCTTGTCAACCAACATATCGGCAACGTACCCTCTTTGGCTGCTGGTCTTATTAGGATGCATTTCCATGATTGCTTCGTTCGG
GGTTGTGATGGTTCGATCTTGATCAACGCG
ACATCAAGAAACCAACAAGTGGAGAAGGTATCTCCACCGAATCTAACTGTTAGAGGTTTCGACTTTATCGATCTAGTGAAGAAAGTTCTCGAATCCAAGTGTCCAGGAATAGTCTCATGT
GCCGATATCATCACTCTCGCTACTAGAGACTCTGTTGCTGCCATT
GGTGGACCAACATGGAGTGTTCCTACAGGACGCAGAGACGGACGTATCTCTAATGCTAACGAGTCTTTGAATAAT
ATCCCTCCTCCTTTTGGAAACTTCACGACTCTTATAACTCTCTTTGGAAACCAAGGACTTGATGTTAAGGACCTAGTCTTGTTATCCG
GTGCGCATACTATTGGAGTGTCTCATTGCTCC
TCCTTCTCGAACCGTCTTTTCAACTTTACTGGCGTCGGAGATCAAGATCCATCGCTCGACAGTGAATACGCAGACAATCTCAAAGCAAGAAGATGTTTGTCTCTCGCCGACAATACCACA
AAGGTCGAAATGGATCCTGGTAGTCGAAACACCTTCGATCTTAGTTACTTTAGGCTAGTCTTGAAACGTCGTGGACTTTTTGAGTCTGACGCGGCGTTGACTATGAATTCGGCTGCGTTG
GCTCTGGTTAGACGCTTTGCTGGAGGATCTGAGCAAGATTTCTTCGTTGAGTTCGGAAAGTCGATGGAGAAAATGGGAAGGATTGGTGTAAAAACCGGGTCGGATGGGGAAATTCGAAGA
ACCTGTGCAGTGGTTAATTAA

Retrieve as FASTA