Entry information : TsPrx61 (Thhalv10004528m)
Entry ID 9806
Creation 2011-11-18 (Qiang Li)
Last sequence changes 2011-11-21 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-31 (Christophe Dunand)
Peroxidase information: TsPrx61 (Thhalv10004528m)
Name (synonym) TsPrx61 (Thhalv10004528m)
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Eutrema
Organism Thellungiella salsuginea (Eutrema salsugineum)    [TaxId: 72664 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TsPrx61
start..stop
S start..stop
BstrPrx68 659 0 1..341 1..341
AlyPrx61 656 0 1..341 1..341
BrPrx61-1Aa_other 655 0 1..341 1..341
BoPrx61_other 652 0 1..341 1..341
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3061827..3062075 249 N° 2 3061526..3061705 180 N° 3 3061230..3061389 160 N° 4 3060181..3060617 437
complement(join(3060181..3060617,3061230..3061389,3061526..3061705,3061827..3062 075))


exon

Literature and cross-references TsPrx61 (Thhalv10004528m)
DNA ref. Phytozome 12:   scaffold_6 (3062075..3060181)
Protein sequence: TsPrx61 (Thhalv10004528m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   342 (315)
PWM (Da):   %s   37345.75 (34425.1)  
PI (pH):   %s   8.2 (7.99) Peptide Signal:   %s   cut: 27 range:27-341
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRQFVNFFPLLAFVVISLAGKATVEAATGMNPPVKLVWHYYKVTNTCDDAEAYIRHQVEKFYKSDSTIAPKLLRLLYSDCMVNGCDASVLLQGPKSERTAPQNRGLAGFVIIDKIKTVLESRCPGVVSCADILNLATRDAVHMAGAPSYPVFTGRRDGGALNPDAVDLPSPSISVEESLAYFNSKGLDVLDMTTLLGAHSMGKTHCSHIVNRLYNFKSTGKPDPTMNTTLVSQLRNLCPPRTQKGQTDPLIYLNPDTGSSNRFSSSYYSRVLSHNAVLGVDQQLLYNDDSKEITQEFASGFEDFRKSFALAMSRMGSINVLTGNAGEIRRDCRVTNANYGA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No EST. Containing motif 'YSDC'.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGCAGTTTGTGAACTTTTTCCCACTATTGGCCTTCGTAGTCATAAGCTTAGCTGGAAAGGCGACAGTAGAGGCTGCGACGGGAATGAACCCTCCGGTGAAGCTGGTTTGGCATTAT
TACAAAGTTACTAACACTTGTGATGATGCAGAGGCTTATATTAGACACCAAGTCGAGAAGTTTTATAAAAGTGACAGTACCATTGCTCCCAAGCTCCTTCGCCTCCTCTATTCCGATTGT
ATGGTTAAT
GTAAGTAAAATGTCGCCATTAATTTTCTTCACAATAATAGCAACAAGAACATTACCTTCATTTTTTTGTTTTTTTGTTTTTGTTTTTATAACCTATGTAAAATGTGTGTAT
ATATATGTAGGGATGTGATGCTTCGGTTCTTTTACAAGGACCAAAATCAGAGAGAACGGCTCCGCAGAATCGAGGACTTGCGGGTTTTGTGATAATCGATAAGATAAAAACAGTTCTTGA
GTCACGTTGTCCTGGTGTCGTTTCTTGCGCTGATATCCTCAACCTTGCCACTAGAGATGCTGTTCATATG
GTACATATGTACACTCTTATATATAGTGCATGTTCTAATACGAGAGGATC
GATATTCGATTATTGTGGTTAATTTTGTAATGCTCTTTACTCATTAGTGTTGTTTTGATGGATTAATTTGATAATATCATGATTAGGCCGGAGCACCCTCTTACCCTGTGTTTACGGGGA
GAAGGGACGGTGGTGCATTAAATCCAGACGCCGTGGATCTTCCGTCACCGTCCATCTCAGTCGAGGAGTCGTTGGCATACTTCAATTCCAAAGGTCTTGACGTTTTGGATATGACTACTC
TTCTAG
GTAACTCATCAATTTTTCCTTCTTTCCAAATTAGACTCAGGCGTCTTTTATCATTTCTTCGACTAATCGCAATGCTACTACTAAAACTTTAATTGTTTAATACTGAGTTTTCTC
AAATACTTATATTTAGAGTCTATTTTTTCCCAAAACCATAAGCATCTTGAGCAAAATTCATTTGTTAATTGTAAATGTATACCCCAAATGAATTCCTTCCACTTGTGTTTGGCGTTTGTG
TTTGCAATTTGAAAAATCCTTTGTGATACACAAATGTTTTAGTTTTATTATACGTCAACTTTTCTTGTTTTTTTTTGTTTTTCGTTTTTCAAATGCAAACACATAAATTGCGTTTGAAAC
AATCTGAGATCTAATTAGCATTAAACAGTTGTATGTAAAATGAAAAAAAAACCCTAAAGTTTGTAATTTTAAAAAATGTTTGGTAGAGATGAAGATCTTCTCACTACATAAAAAATGTAA
CTACTATAAAGTTTAAATCACTGTAAACATGCAAGACAGTTACTTAATAGAAACGTGGATCTAAATTATATCCTATTGGGTCTCTGACATTGTCGTCTTTCTAACAACCTCTAATTATGT
TATTTGTAATGGGAACAGGAGCACACTCGATGGGGAAGACACATTGCAGCCACATAGTGAACAGACTATACAACTTCAAGAGTACAGGGAAACCAGATCCGACCATGAACACGACCTTGG
TGTCACAACTTCGAAATCTTTGTCCTCCAAGAACACAAAAAGGCCAAACCGATCCACTGATTTACTTAAACCCAGACACAGGATCGAGCAACAGATTCAGCAGCTCCTATTATTCTCGTG
TCTTGTCTCATAACGCTGTCTTGGGCGTGGACCAACAGTTGCTCTACAACGATGACTCGAAGGAGATCACGCAAGAGTTCGCTTCAGGCTTCGAAGATTTCAGAAAGTCTTTTGCATTGG
CAATGTCGAGGATGGGATCTATCAATGTATTGACCGGAAATGCTGGAGAGATTCGCCGAGATTGCAGAGTTACTAACGCTAATTACGGGGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGCAGTTTGTGAACTTTTTCCCACTATTGGCCTTCGTAGTCATAAGCTTAGCTGGAAAGGCGACAGTAGAGGCTGCGACGGGAATGAACCCTCCGGTGAAGCTGGTTTGGCATTAT
TACAAAGTTACTAACACTTGTGATGATGCAGAGGCTTATATTAGACACCAAGTCGAGAAGTTTTATAAAAGTGACAGTACCATTGCTCCCAAGCTCCTTCGCCTCCTCTATTCCGATTGT
ATGGTTAAT
GGATGTGATGCTTCGGTTCTTTTACAAGGACCAAAATCAGAGAGAACGGCTCCGCAGAATCGAGGACTTGCGGGTTTTGTGATAATCGATAAGATAAAAACAGTTCTTGAG
TCACGTTGTCCTGGTGTCGTTTCTTGCGCTGATATCCTCAACCTTGCCACTAGAGATGCTGTTCATATG
GCCGGAGCACCCTCTTACCCTGTGTTTACGGGGAGAAGGGACGGTGGTGCA
TTAAATCCAGACGCCGTGGATCTTCCGTCACCGTCCATCTCAGTCGAGGAGTCGTTGGCATACTTCAATTCCAAAGGTCTTGACGTTTTGGATATGACTACTCTTCTAG
GAGCACACTCG
ATGGGGAAGACACATTGCAGCCACATAGTGAACAGACTATACAACTTCAAGAGTACAGGGAAACCAGATCCGACCATGAACACGACCTTGGTGTCACAACTTCGAAATCTTTGTCCTCCA
AGAACACAAAAAGGCCAAACCGATCCACTGATTTACTTAAACCCAGACACAGGATCGAGCAACAGATTCAGCAGCTCCTATTATTCTCGTGTCTTGTCTCATAACGCTGTCTTGGGCGTG
GACCAACAGTTGCTCTACAACGATGACTCGAAGGAGATCACGCAAGAGTTCGCTTCAGGCTTCGAAGATTTCAGAAAGTCTTTTGCATTGGCAATGTCGAGGATGGGATCTATCAATGTA
TTGACCGGAAATGCTGGAGAGATTCGCCGAGATTGCAGAGTTACTAACGCTAATTACGGGGCTTAA

Retrieve as FASTA