Entry information : TsPrx44 (Thhalv10025781m)
Entry ID 9817
Creation 2011-11-18 (Qiang Li)
Last sequence changes 2011-11-21 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-31 (Christophe Dunand)
Peroxidase information: TsPrx44 (Thhalv10025781m)
Name (synonym) TsPrx44 (Thhalv10025781m)
Class Class III peroxidase    [Orthogroup: Prx019]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Eutrema
Organism Thellungiella salsuginea (Eutrema salsugineum)    [TaxId: 72664 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TsPrx44
start..stop
S start..stop
BrPrx44-2Ab_other 590 0 1..312 1..312
CrubPrx117 590 0 1..312 1..312
CrubPrx65 588 0 1..312 1..312
AlyPrx44-1 586 0 1..312 1..312
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5976314..5976514 201 N° 2 5975765..5976201 437 N° 3 5975332..5975632 301  
complement(join(5975332..5975632,5975765..5976201,5976314..5976514))


exon

Literature and cross-references TsPrx44 (Thhalv10025781m)
DNA ref. Phytozome 12:   scaffold_1 (5976514..5975332)
Protein sequence: TsPrx44 (Thhalv10025781m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   313 (292)
PWM (Da):   %s   34367.68 (31933.4)  
PI (pH):   %s   11.28 (11.29) Peptide Signal:   %s   cut: 21 range:21-312
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRSITALFFLFCFLVPSSFAQLRFGFYGRSCPRAESIVANVVANRFRRDRSITAALLRMQFHDCFVRGCDASLLIDPRPGRPSEKSTGPNASVRGYEIIDEAKRLLEAACPRTVSCSDIVTLATRDSVALAGGPRFSVPTGRRDGLRSSPNDVNLPGPTIPVAASINLFAAQGMNTNDMVTLIGGGHSVGVAHCSLFRDRLNDPAMERTLNARLRNTCRAPNDPSVFLDQRTPFIVDNAIYGEIRRQRGILRIDQNMGLDRSTRGIVSSFASSNVLFRQRFAQAMVKMGTIKVLTGRSGEIRRNCRVFNNGR*

Retrieve as FASTA  
Remarks Complete sequence fromm genomic (intron 1 and 3'). No EST. Extra intron 3' when compared with orthologs!!!
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGTCAATCACAGCTTTGTTTTTCCTTTTCTGCTTCCTTGTTCCCTCTTCTTTTGCGCAGCTCCGATTTGGGTTCTACGGACGCTCATGCCCTCGCGCCGAGTCTATTGTTGCTAAT
GTTGTTGCCAACCGTTTCCGCCGTGACCGTAGCATTACCGCAGCATTGCTTCGTATGCAGTTTCATGATTGCTTTGTCAGG
GTTCGTAAGCTTCTCCATGTGTGTCTATATATATATATA
TATATATATATCATGGTCTTGCTAATATGTAGACATAACATTGATCAAGAAATTGTGTTGAATGGTTGTGTAGGGTTGTGATGCTTCCCTCTTGATCGACCCAAGACCCGGAAGGCCATC
AGAGAAAAGCACCGGACCAAATGCAAGTGTGAGAGGCTACGAGATCATTGATGAGGCAAAGAGACTGCTCGAGGCTGCTTGTCCCCGAACTGTCTCATGCTCAGACATTGTTACTCTAGC
CACCAGAGACTCTGTCGCATTAGCTGGTGGTCCAAGGTTCTCAGTACCAACAGGAAGACGTGATGGATTAAGGTCAAGCCCCAATGATGTGAACTTGCCCGGACCAACAATTCCCGTGGC
TGCATCCATCAATTTATTTGCAGCTCAAGGCATGAACACGAACGACATGGTTACACTTATTGGTGGTGGCCACAGCGTCGGTGTTGCCCATTGCAGTCTCTTCCGGGATAGGCTTAACGA
CCCTGCAATGGAACGCACATTGAATGCTAG
GTACGTATTTATATGGCTAGCTTAGCTAGGTTCATTTTAAGAAAAATAAAAAAAAATTGTCAATAACATGCATTATAGACAATACTAATA
CTTATATTTCTGAGTTCTGACCCATTAATACATCTCTTTAAGGTTGAGGAACACATGTCGCGCTCCAAATGACCCATCTGTGTTCTTGGACCAAAGGACTCCATTCATTGTGGATAACGC
AATCTACGGAGAGATCAGAAGACAGAGAGGAATCCTGAGGATTGATCAAAACATGGGTCTCGATAGATCAACACGTGGAATTGTGTCGAGTTTTGCATCAAGCAATGTGCTCTTTAGACA
GAGATTTGCTCAAGCAATGGTGAAAATGGGTACCATTAAGGTTCTTACTGGACGATCCGGAGAGATCAGGAGGAACTGCAGAGTCTTCAACAACGGACGTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGTCAATCACAGCTTTGTTTTTCCTTTTCTGCTTCCTTGTTCCCTCTTCTTTTGCGCAGCTCCGATTTGGGTTCTACGGACGCTCATGCCCTCGCGCCGAGTCTATTGTTGCTAAT
GTTGTTGCCAACCGTTTCCGCCGTGACCGTAGCATTACCGCAGCATTGCTTCGTATGCAGTTTCATGATTGCTTTGTCAGG
GGTTGTGATGCTTCCCTCTTGATCGACCCAAGACCCGGA
AGGCCATCAGAGAAAAGCACCGGACCAAATGCAAGTGTGAGAGGCTACGAGATCATTGATGAGGCAAAGAGACTGCTCGAGGCTGCTTGTCCCCGAACTGTCTCATGCTCAGACATTGTT
ACTCTAGCCACCAGAGACTCTGTCGCATTAGCTGGTGGTCCAAGGTTCTCAGTACCAACAGGAAGACGTGATGGATTAAGGTCAAGCCCCAATGATGTGAACTTGCCCGGACCAACAATT
CCCGTGGCTGCATCCATCAATTTATTTGCAGCTCAAGGCATGAACACGAACGACATGGTTACACTTATTGGTGGTGGCCACAGCGTCGGTGTTGCCCATTGCAGTCTCTTCCGGGATAGG
CTTAACGACCCTGCAATGGAACGCACATTGAATGCTAG
GTTGAGGAACACATGTCGCGCTCCAAATGACCCATCTGTGTTCTTGGACCAAAGGACTCCATTCATTGTGGATAACGCAATC
TACGGAGAGATCAGAAGACAGAGAGGAATCCTGAGGATTGATCAAAACATGGGTCTCGATAGATCAACACGTGGAATTGTGTCGAGTTTTGCATCAAGCAATGTGCTCTTTAGACAGAGA
TTTGCTCAAGCAATGGTGAAAATGGGTACCATTAAGGTTCTTACTGGACGATCCGGAGAGATCAGGAGGAACTGCAGAGTCTTCAACAACGGACGTTGA

Retrieve as FASTA