Entry information : TsPrx45 (Thhalv10025699m)
Entry ID 9820
Creation 2011-11-18 (Qiang Li)
Last sequence changes 2011-11-21 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-10-22 (Christophe Dunand)
Peroxidase information: TsPrx45 (Thhalv10025699m)
Name (synonym) TsPrx45 (Thhalv10025699m)
Class Class III peroxidase    [Orthogroup: Prx020]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Eutrema
Organism Thellungiella salsuginea (Eutrema salsugineum)    [TaxId: 72664 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TsPrx45
start..stop
S start..stop
BrPrx45-1Ab_other 635 0 3..327 1..324
BnPrx45-2_other 635 0 3..327 1..324
BrPrx45-1Aa_other 631 0 3..327 1..325
BnPrx45-1_other 631 0 3..327 1..325
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4180481..4180702 222 N° 2 4180094..4180282 189 N° 3 4179561..4179726 166 N° 4 4179062..4179468 407
complement(join(4179062..4179468,4179561..4179726,4180094..4180282,4180481..4180 702))


exon

Literature and cross-references TsPrx45 (Thhalv10025699m)
DNA ref. Phytozome 12:   scaffold_1 (4180702..4179062)
Protein sequence: TsPrx45 (Thhalv10025699m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (300)
PWM (Da):   %s   36251.42 (33084.8) Transmb domain:   %s   i12-34o
PI (pH):   %s   10.1 (10.21) Peptide Signal:   %s   cut: 28 range:28-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAMEKKTNQSIFYIFSLLLLFSSCVSAQLRTGFYRNSCPNVENIVRNAVRQKFQQTFVTAPATLRLFFHDCFVRGCDASILIASPSEKDHPDDVSLAGDGFDTVAKAKQAVDSDPNCRNKVSCADILALATREVVVLTGGPSYPVELGRRDGRLSTKASVQHSLPQPGFNLNQLNTMFNRHGLSQTDMIALSGAHTIGFAHCGKFSKRIYNFSPRTRIDPSLNRGYALQLRQMCPVRVDPRIAINMDPTTPRTFDNAYFKNLQQGRGLFTSDQVLFTDQRSRSTVNLFANSEGAFRQAFISAITKLGRVGVKTGNAGEIRRDCSRVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCATGGAGAAGAAGACTAACCAAAGCATCTTCTACATATTTTCTCTTCTTCTTCTCTTTTCTTCATGTGTCTCTGCTCAGCTCCGGACAGGTTTCTACCGGAACTCATGCCCGAAC
GTTGAAAACATTGTCCGTAACGCCGTCCGTCAGAAATTCCAGCAGACTTTCGTCACGGCTCCGGCCACTCTCCGCCTCTTCTTCCACGATTGCTTCGTTCGC
GTACGTATTAAAATTTTT
ATATATGTCAAACAAAAAAATTCATGTTCTTAACAAAGGTTTTGAATGTATAAGAATTGTGATCATATTTTCTTACGAATATTAAATTCAGTTTTGATTGATAATCTGCGCATGCAAAAT
CTCTGAATATTAAATTCATCTTTACGTACTTAATTTCTTATTTTATATGAATATATATAGGGATGTGATGCTTCCATATTGATAGCATCTCCATCGGAGAAAGATCATCCAGATGACGTA
TCATTGGCCGGAGATGGATTCGACACGGTGGCGAAGGCAAAGCAGGCAGTTGATAGCGATCCTAACTGCCGCAACAAAGTCTCATGTGCTGACATTTTGGCTCTCGCTACTCGTGAAGTC
GTCGTTTTG
GTATGAATATATAACTTTTCCTAGTAAACATTTATATTCATCTCTCTCTTAAATAAATTATATTAACATTAATGTCCGAGGTTTTGAACATTCGTTTTTTTATCTCATTAC
TATATATATCGTTTCGGGTGCAAAAGCTATATACCCACATCATTAGATATAAAAAGCATAATTCAAGTCTAAGAAACAATATATAATATTTTGTAGTAATAAAATGACACCTTCTATTGA
CGGTTTCTAATTATTTTATTTTTAAACAAGTACGTACAAGTAGCAACAGGTCAAATGGTCCGAATAAAAACGAATTATTGATGGATTATAATAATAATTATTGTCAGATGATTAAAAAAT
AAATACAAAATTGCAGACCGGAGGACCGAGCTACCCGGTGGAGCTAGGGAGGAGAGATGGCAGATTATCTACAAAGGCAAGCGTTCAACACAGTTTGCCTCAGCCCGGTTTTAACCTGAA
CCAGCTCAACACTATGTTCAACCGTCACGGTCTCTCTCAAACCGACATGATCGCTCTCTCAG
GTACGTACCAAAACCTTACTAAACCGATTTCATTTTCGTTAATATTTGACCAAATCTG
TATCATTTAATAAAAATGTTATTGTAAAATTCAGGAGCGCACACAATCGGATTCGCACACTGTGGGAAATTCTCGAAGCGAATTTACAATTTTAGCCCTAGAACCCGTATCGACCCGAGT
TTAAACCGTGGGTACGCACTTCAGCTTCGACAGATGTGTCCGGTCCGGGTCGACCCAAGAATCGCGATCAACATGGACCCCACCACCCCACGTACTTTCGACAATGCTTACTTCAAGAAT
CTCCAACAAGGGAGGGGTTTATTTACGTCTGATCAAGTCTTGTTCACGGATCAACGGTCTAGATCAACGGTTAACTTGTTTGCCAACAGTGAAGGAGCTTTTAGGCAAGCTTTTATCTCG
GCGATCACGAAACTGGGTCGTGTCGGGGTTAAGACTGGTAATGCCGGTGAGATACGAAGAGATTGTTCACGTGTCAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCATGGAGAAGAAGACTAACCAAAGCATCTTCTACATATTTTCTCTTCTTCTTCTCTTTTCTTCATGTGTCTCTGCTCAGCTCCGGACAGGTTTCTACCGGAACTCATGCCCGAAC
GTTGAAAACATTGTCCGTAACGCCGTCCGTCAGAAATTCCAGCAGACTTTCGTCACGGCTCCGGCCACTCTCCGCCTCTTCTTCCACGATTGCTTCGTTCGC
GGATGTGATGCTTCCATA
TTGATAGCATCTCCATCGGAGAAAGATCATCCAGATGACGTATCATTGGCCGGAGATGGATTCGACACGGTGGCGAAGGCAAAGCAGGCAGTTGATAGCGATCCTAACTGCCGCAACAAA
GTCTCATGTGCTGACATTTTGGCTCTCGCTACTCGTGAAGTCGTCGTTTTG
ACCGGAGGACCGAGCTACCCGGTGGAGCTAGGGAGGAGAGATGGCAGATTATCTACAAAGGCAAGCGTT
CAACACAGTTTGCCTCAGCCCGGTTTTAACCTGAACCAGCTCAACACTATGTTCAACCGTCACGGTCTCTCTCAAACCGACATGATCGCTCTCTCAG
GAGCGCACACAATCGGATTCGCA
CACTGTGGGAAATTCTCGAAGCGAATTTACAATTTTAGCCCTAGAACCCGTATCGACCCGAGTTTAAACCGTGGGTACGCACTTCAGCTTCGACAGATGTGTCCGGTCCGGGTCGACCCA
AGAATCGCGATCAACATGGACCCCACCACCCCACGTACTTTCGACAATGCTTACTTCAAGAATCTCCAACAAGGGAGGGGTTTATTTACGTCTGATCAAGTCTTGTTCACGGATCAACGG
TCTAGATCAACGGTTAACTTGTTTGCCAACAGTGAAGGAGCTTTTAGGCAAGCTTTTATCTCGGCGATCACGAAACTGGGTCGTGTCGGGGTTAAGACTGGTAATGCCGGTGAGATACGA
AGAGATTGTTCACGTGTCAATTAG

Retrieve as FASTA