Entry information : TsPrx51 (Thhalv10025695m)
Entry ID 9821
Creation 2011-11-18 (Qiang Li)
Last sequence changes 2011-11-21 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-07-27 (Christophe Dunand)
Peroxidase information: TsPrx51 (Thhalv10025695m)
Name (synonym) TsPrx51 (Thhalv10025695m)
Class Class III peroxidase    [Orthogroup: Prx011]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Eutrema
Organism Thellungiella salsuginea (Eutrema salsugineum)    [TaxId: 72664 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TsPrx51
start..stop
S start..stop
ThPrx51 676 0 1..328 1..328
BrPrx50-1Aa_other 608 0 18..328 16..326
BnPrx50-1_other 608 0 18..328 16..326
BoPrx50_other 605 0 18..328 16..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1021138..1021350 213 N° 2 1020850..1021050 201 N° 3 1020587..1020752 166 N° 4 1019933..1020339 407
complement(join(1019933..1020339,1020587..1020752,1020850..1021050,1021138..1021 350))


exon

Literature and cross-references TsPrx51 (Thhalv10025695m)
Literature Taji,T., Sakurai,T., Mochida,K., Ishiwata,A., Kurotani,A., Totoki,Y., Toyoda,A., Sakaki,Y., Seki,M., Ono,H., Sakata,Y., Tanaka,S. and Shinozaki,K. BMC Plant Biol. 8, 115 (2008).
DNA ref. Phytozome 12:   scaffold_1 (1021350..1019933)
EST ref. GenBank:   BAJ34486
Protein sequence: TsPrx51 (Thhalv10025695m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (304)
PWM (Da):   %s   35988.48 (33276.9) Transmb domain:   %s   i7-24o
PI (pH):   %s   9.58 (9.43) Peptide Signal:   %s   cut: 25 range:25-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATNKTNLLLLLLSLFLTLNLVSAQLRRNFYAGSCPNVEQIVRSAVQQKIQQTFTTIPATLRLYFHDCFVNGCDASVMIASTNNNKAEKDHPDNLSLAGDGFDTVIKAKQVLDAVANCRNKVSCADILTIATRDVVNLAGGPRYEVELGRLDGLSSSAASVEGKLPHPTDDVNQLTSLFAKNGLSLKDMIALSGAHTLGFAHCTKVFNRIYSFNKTTKVDPTVNKAYVAELQASCPRNIDPRVAINMDPTTPRQFDNVYYKNLQQGKGLFTSDQVLFTDRRSKPTVDLWANNAKLFNQAFGNSMIRLGRVGVKTGRNGNIRRDCGAFN*

Retrieve as FASTA  
Remarks Complete sequence fromm genomic and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACGAACAAAACGAATCTCTTATTGCTTCTTCTCTCTCTCTTTCTCACCCTAAACCTCGTCTCGGCTCAACTCCGCCGCAACTTCTACGCCGGAAGTTGTCCCAACGTCGAACAA
ATCGTCAGAAGCGCCGTTCAGCAAAAGATTCAACAAACCTTCACCACCATCCCCGCCACTCTCCGCCTCTATTTCCATGATTGTTTCGTCAAT
GTAACACATTTTTTCATTTATCTTTCT
TCTTGATTGAATTAATTTCAATTTATGAAATCAATTAATTATATTACTATCATATAACAGGGTTGTGATGCATCGGTGATGATAGCGTCGACTAATAATAATAAGGCGGAGAAAGACCAT
CCAGATAATTTATCTTTGGCCGGAGATGGCTTCGATACCGTCATTAAAGCTAAACAAGTTCTTGACGCCGTCGCAAATTGTCGTAACAAAGTTTCTTGCGCCGATATTCTCACGATAGCT
ACTCGTGACGTTGTCAATCTC
GTTCGTATACCATCACTATCATATTTTATTACATTAAACGTCTCTAATTAAAACATTATTTGTTAATATTAATTTTACATATAATTAATTCATATAGGC
GGGTGGACCAAGATATGAAGTTGAATTAGGGAGGCTAGATGGGCTTTCGTCGTCGGCGGCTAGCGTCGAAGGGAAGCTTCCACATCCGACGGACGATGTTAACCAACTCACTTCACTTTT
TGCCAAAAACGGTCTTTCCCTTAAGGACATGATCGCTCTCTCCG
GTAAGCTTTTTGTCCTATTTCTCGACCGGGAACAGTATTATTCGGCTAGTTTAATATCAAGAATATTTACTTTTTG
ATTAGGATCTGATATGGTTTTAGATTTTTTTTTTTTTTTTTTAAAGCAAGTATGTTGAGTAATTGCTTTTATTTAATTTCGGTTTATCTGATCCGGTTATTACGATATCTAGGCTTACAA
TTTTCCGGTCCTAATTTAAATTTGGTTCGATCAATAAAAAAAAAAAAACAGGAGCGCACACATTAGGATTCGCGCATTGCACCAAAGTGTTCAATCGGATTTACAGTTTCAACAAGACAA
CTAAAGTGGATCCCACAGTTAACAAAGCTTACGTGGCAGAGTTACAAGCGTCTTGTCCTAGAAACATAGATCCAAGAGTGGCTATAAACATGGACCCCACAACACCTAGACAGTTCGACA
ACGTTTACTATAAAAACCTGCAACAAGGGAAAGGATTGTTCACGTCAGATCAAGTTTTGTTCACTGATCGTCGGTCAAAGCCAACCGTTGACTTATGGGCCAATAATGCAAAGCTGTTTA
ATCAAGCTTTTGGTAACTCCATGATCAGGCTTGGTCGTGTTGGTGTTAAAACCGGACGCAATGGTAATATCCGTCGTGATTGTGGAGCTTTTAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACGAACAAAACGAATCTCTTATTGCTTCTTCTCTCTCTCTTTCTCACCCTAAACCTCGTCTCGGCTCAACTCCGCCGCAACTTCTACGCCGGAAGTTGTCCCAACGTCGAACAA
ATCGTCAGAAGCGCCGTTCAGCAAAAGATTCAACAAACCTTCACCACCATCCCCGCCACTCTCCGCCTCTATTTCCATGATTGTTTCGTCAAT
GGTTGTGATGCATCGGTGATGATAGCG
TCGACTAATAATAATAAGGCGGAGAAAGACCATCCAGATAATTTATCTTTGGCCGGAGATGGCTTCGATACCGTCATTAAAGCTAAACAAGTTCTTGACGCCGTCGCAAATTGTCGTAAC
AAAGTTTCTTGCGCCGATATTCTCACGATAGCTACTCGTGACGTTGTCAATCTC
GCGGGTGGACCAAGATATGAAGTTGAATTAGGGAGGCTAGATGGGCTTTCGTCGTCGGCGGCTAGC
GTCGAAGGGAAGCTTCCACATCCGACGGACGATGTTAACCAACTCACTTCACTTTTTGCCAAAAACGGTCTTTCCCTTAAGGACATGATCGCTCTCTCCG
GAGCGCACACATTAGGATTC
GCGCATTGCACCAAAGTGTTCAATCGGATTTACAGTTTCAACAAGACAACTAAAGTGGATCCCACAGTTAACAAAGCTTACGTGGCAGAGTTACAAGCGTCTTGTCCTAGAAACATAGAT
CCAAGAGTGGCTATAAACATGGACCCCACAACACCTAGACAGTTCGACAACGTTTACTATAAAAACCTGCAACAAGGGAAAGGATTGTTCACGTCAGATCAAGTTTTGTTCACTGATCGT
CGGTCAAAGCCAACCGTTGACTTATGGGCCAATAATGCAAAGCTGTTTAATCAAGCTTTTGGTAACTCCATGATCAGGCTTGGTCGTGTTGGTGTTAAAACCGGACGCAATGGTAATATC
CGTCGTGATTGTGGAGCTTTTAACTGA

Retrieve as FASTA