Entry information : NcGPx01
Entry ID 9836
Creation 2011-11-22 (Passaia Gisèle)
Last sequence changes 2012-02-29 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-25 (Catherine Mathe (Scipio))
Peroxidase information: NcGPx01
Name NcGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Sordariaceae Neurospora
Organism Neurospora crassa    [TaxId: 5141 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value NcGPx01
start..stop
S start..stop
NtetGPx01_2509 465 7e-170 1..229 1..227
SmaGPx01 377 4e-135 1..229 1..224
NdisGPx01 340 3e-121 63..229 1..167
StheGPx01 295 2e-102 43..229 51..237
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4499554..4499782 229 N° 2 4499011..4499468 458  
complement(join(4499011..4499468,4499554..4499782))


exon

Literature and cross-references NcGPx01
Literature Hammond TM et al. Fine-scale mapping in Neurospora crassa by using genome-wide knockout strains. Mycologia. 2011 Nov 8.
Protein ref. UniProtKB:   Q7S060 [Incorrect prediction]
DNA ref. JGI genome:   supercont10.5 (4499782..4499011)
EST ref. GenBank:   AI392289
Protein sequence: NcGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   229
PWM (Da):   %s   25871.5  
PI (pH):   %s   9.94
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MIPRYHHRSVATLARTSLTTRHLKLSPILPQQQQQQPRLPVSKPAFRCQPAISRRFATTTLNMSSATTIYDFKPLDKKGSELPLSTYQGKVVLIVNVASKCGFTPQYAGLEKVYKEIKEKYPDDFEILAFPCNQFGGQEPGTEEEIQSFCQLNYGVSFPIMKKVEVNGDNADPLYEWMKNEKPGLMGLKRIKWNFEKFLIGKDGKVKGRWASTTKPESLKEAILKELG

Retrieve as FASTA  
Remarks Complete sequence from genomic (supercontig 10, 1 intron) and 1 EST (bad quality). Strain="ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987" and "OR74A".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATACCCCGCTACCATCATCGCTCAGTAGCTACACTTGCTCGCACCTCACTCACCACTCGTCATTTGAAACTATCACCGATTCTACCTCAACAACAACAACAACAACCTCGACTGCCA
GTTTCCAAACCAGCATTCCGTTGCCAGCCAGCCATTTCCAGACGCTTCGCAACAACCACACTTAACATGTCTTCTGCCACTACTATCTACGACTTTAAGCCCCTTGACA
GTAAGCAGCCC
TCGCCCTTCTTTATCTTAGTCTCTCACCACCACATCATCATCATTATCACCACCCATACTAACCAAACCCACAGAGAAGGGCTCCGAACTCCCCCTCTCCACCTACCAAGGCAAGGTAGT
CCTGATCGTCAACGTTGCCTCCAAATGCGGTTTCACGCCTCAATACGCCGGCCTGGAAAAGGTCTACAAGGAGATCAAGGAGAAGTACCCGGACGATTTTGAGATCCTCGCTTTCCCTTG
CAACCAGTTCGGCGGACAGGAGCCGGGCACCGAGGAGGAGATCCAGTCGTTCTGCCAGCTCAACTATGGCGTTTCCTTCCCCATCATGAAGAAGGTGGAGGTCAACGGCGACAATGCTGA
TCCCCTCTATGAATGGATGAAGAATGAGAAGCCTGGCCTGATGGGATTGAAGAGAATCAAGTGGAACTTTGAAAAGTTCTTGATTGGAAAGGATGGAAAGGTCAAGGGACGGTGGGCGAG
CACTACGAAGCCTGAGTCTCTGAAGGAGGCTATCCTTAAGGAGTTGGGCGAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATACCCCGCTACCATCATCGCTCAGTAGCTACACTTGCTCGCACCTCACTCACCACTCGTCATTTGAAACTATCACCGATTCTACCTCAACAACAACAACAACAACCTCGACTGCCA
GTTTCCAAACCAGCATTCCGTTGCCAGCCAGCCATTTCCAGACGCTTCGCAACAACCACACTTAACATGTCTTCTGCCACTACTATCTACGACTTTAAGCCCCTTGACA
AGAAGGGCTCC
GAACTCCCCCTCTCCACCTACCAAGGCAAGGTAGTCCTGATCGTCAACGTTGCCTCCAAATGCGGTTTCACGCCTCAATACGCCGGCCTGGAAAAGGTCTACAAGGAGATCAAGGAGAAG
TACCCGGACGATTTTGAGATCCTCGCTTTCCCTTGCAACCAGTTCGGCGGACAGGAGCCGGGCACCGAGGAGGAGATCCAGTCGTTCTGCCAGCTCAACTATGGCGTTTCCTTCCCCATC
ATGAAGAAGGTGGAGGTCAACGGCGACAATGCTGATCCCCTCTATGAATGGATGAAGAATGAGAAGCCTGGCCTGATGGGATTGAAGAGAATCAAGTGGAACTTTGAAAAGTTCTTGATT
GGAAAGGATGGAAAGGTCAAGGGACGGTGGGCGAGCACTACGAAGCCTGAGTCTCTGAAGGAGGCTATCCTTAAGGAGTTGGGCGAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATCAAGACCA CCTTTCGCCT CTCATTCGTG TCATTCTCGG CTCCTTTGAT TTTTGTCCTT GCTTGCACAT ACCATATGAT ACCCCGCTAC CATCATCGCT CAGTAGCTAC ACTTGCTCGC  ACCTCACTCA CCACTCGTCA TTTGAAACTA TCACCGATTC TACCTCAACA ACAACAACAA CAACCTCGAC TGCCAGTTTC CAAACCAGCA TTCCGTTGCC AGCCAGCCAT TTCCAGACGC  TTCGCAACAA CCACACTTAA CATGTCTTCT GCCACTACTA TCTACGACTT TAAGCCCCTT GACAAGAAGG GCTCCGAACT CCCCCTCTCC ACCTACCAAG GCAAGGTAGT CCTGATCGTC  AACGTTGCCT CCAAATGCGG TTTCACGCCT CAATACGCCG GCCTGGAAAA GGTCTACAAG GAGATCAAGG AGAAGTACCC GGACGATTTT GAGATCCTCG CTTTCCCTTG CAACCAGTTC  GGCGGACAGG AGCCGGGCAC CGAGGAGGAG ATCCAGTCGT TCTGCCAGCT CAACTATGGC GTTTCCTTCC CCATCATGAA GAAGGTGGAG GTCAACGGCG ACAATGCTGA TCCCCTCTAT  GAATGGATGA AGAATGAGAA GCCTGGCCTG ATGGGATTGA AGAGAATCAA GTGGAACTTT GAAAAGTTCT TGATTGGAAA GGATGGAAAG GTCAAGGGAC GGTGGGCGAG CACTACGAAG  CCTGAGTCTC TGAAGGAGGC TATCCTTAAG GAGTTGGGCG AGTAAACTCC TGTTCTGTCT GTGAAGGTTT GAAACGGATG GAAGGTGGCT AAGTCGCCCA AGGATTGTAG GGATGGGGGC  TTGCTAAACT CCAAGTATGG GATGGTTGAG TGCATGATGG TGTGATGCTG TCCTGGGATA AGATTGTCTG GGCCGCGGGA AATGCAAGTT TATACCCCAA GCCATACGTG CTTAATCATC 
TGTCATTAAT GCGATGGGCA AGATTTGATG ACC 

Retrieve as FASTA