Entry information : PEchGPx01
Entry ID 9837
Creation 2011-11-22 (Passaia Gisèle)
Last sequence changes 2012-05-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-09-06 (Catherine Mathe (Scipio))
Peroxidase information: PEchGPx01
Name PEchGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Trichocomaceae Penicillium
Organism Penicillium chrysogenum    [TaxId: 5076 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PEchGPx01
start..stop
S start..stop
AcarGPx01 330 1e-116 1..188 74..261
AnGPx 325 2e-114 1..177 85..261
AflGPx01 322 3e-113 1..190 66..256
NfGPx 319 1e-112 1..190 46..240
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3295167..3295209 43 N° 2 3294535..3295061 527  
complement(join(3294535..3295061,3295167..3295209))


exon

Literature and cross-references PEchGPx01
Protein ref. UniProtKB:   B6HCJ9
DNA ref. JGI genome:   scaffold_3 (3295209..3294535)
mRNA ref. GenBank:   XM_002561976.1
Protein sequence: PEchGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   190
PWM (Da):   %s   20769.57  
PI (pH):   %s   5.39
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSATSFFDFEPVDKKGAPFPLSSLNGKVVLVVNTASKCGFTPQFEGLEKLYQELKAQYPEDFTIIGFPCNQFGSQDPGSDDEIQSFCQLNYGVTFPVLGKLDVNGDNAAPVWTFLKEQQPGIMGMKRVKWNFEKFLVSADGKAVNRWASLTKPEGLKDTIVKEIEKAKKEGTLASLKKSEAGAEQAKL

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron). Accession from NCBI NS_000201.1 (14219641..14218967) present several mismatches.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTCTGCTACATCTTTCTTCGATTTTGAGCCTGTCGACAGTACGTATTAGCTCCTGCGGTGTACCTGCTTATCTTCTCCCCTCATCGCATCCAAATACAAGCTCCGGAGAACCCAA
CCGCTAACGAAATCCCGCATATGAACAGAGAAGGGCGCCCCCTTCCCCCTTTCTTCGCTGAACGGCAAAGTCGTGCTAGTCGTGAACACAGCCTCAAAATGCGGCTTCACGCCCCAGTTT
GAAGGCCTGGAGAAACTCTACCAGGAGCTGAAGGCCCAGTACCCCGAAGACTTCACCATCATCGGATTCCCATGCAACCAGTTCGGCAGCCAAGACCCTGGCTCTGACGATGAGATCCAG
TCTTTCTGTCAACTTAACTACGGCGTTACCTTCCCCGTGCTCGGAAAACTGGATGTGAACGGCGATAACGCTGCACCTGTGTGGACTTTCCTGAAGGAACAGCAGCCTGGGATCATGGGC
ATGAAGCGCGTGAAGTGGAACTTTGAGAAGTTCCTCGTCTCCGCCGATGGAAAGGCTGTTAACCGCTGGGCTTCTCTTACCAAGCCCGAGGGACTTAAGGATACCATTGTTAAGGAGATC
GAGAAGGCGAAGAAGGAGGGCACTCTTGCTTCGCTGAAGAAGAGTGAGGCTGGTGCTGAGCAGGCTAAGCTGTCG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTCTGCTACATCTTTCTTCGATTTTGAGCCTGTCGACAAGAAGGGCGCCCCCTTCCCCCTTTCTTCGCTGAACGGCAAAGTCGTGCTAGTCGTGAACACAGCCTCAAAATGCGGC
TTCACGCCCCAGTTTGAAGGCCTGGAGAAACTCTACCAGGAGCTGAAGGCCCAGTACCCCGAAGACTTCACCATCATCGGATTCCCATGCAACCAGTTCGGCAGCCAAGACCCTGGCTCT
GACGATGAGATCCAGTCTTTCTGTCAACTTAACTACGGCGTTACCTTCCCCGTGCTCGGAAAACTGGATGTGAACGGCGATAACGCTGCACCTGTGTGGACTTTCCTGAAGGAACAGCAG
CCTGGGATCATGGGCATGAAGCGCGTGAAGTGGAACTTTGAGAAGTTCCTCGTCTCCGCCGATGGAAAGGCTGTTAACCGCTGGGCTTCTCTTACCAAGCCCGAGGGACTTAAGGATACC
ATTGTTAAGGAGATCGAGAAGGCGAAGAAGGAGGGCACTCTTGCTTCGCTGAAGAAGAGTGAGGCTGGTGCTGAGCAGGCTAAGCTGTCG

Retrieve as FASTA