Entry information : PoCIIBA01_PC15 (MnP-short)
Entry ID 9842
Creation 2011-11-25 (Christophe Dunand)
Last sequence changes 2011-11-25 (Christophe Dunand)
Sequence status complete
Reviewer Nizar Fawal
Last annotation changes 2012-08-22 (Nizar Fawal)
Peroxidase information: PoCIIBA01_PC15 (MnP-short)
Name (synonym) PoCIIBA01_PC15 (MnP-short)
Class Other class II peroxidase type A    [Orthogroup: CIIBA001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Pleurotaceae Pleurotus
Organism Pleurotus ostreatus (Oyster mushroom)    [TaxId: 5322 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PoCIIBA01_PC15
start..stop
S start..stop
PoCIIBA01_C9 724 0 1..358 1..358
PoCIIBA02_C9 568 0 1..358 1..360
PoCIIBA02_PC15 568 0 1..358 1..360
ParcCIIBA04 508 0 23..358 26..361
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1137520..1137627 108 N° 2 1137423..1137466 44 N° 3 1137353..1137372 20 N° 4 1137279..1137295 17
N° 5 1137218..1137226 9 N° 6 1137104..1137162 59 N° 7 1137029..1137042 14 N° 8 1136937..1136978 42
N° 9 1136808..1136886 79 N° 10 1136518..1136758 241 N° 11 1136266..1136464 199 N° 12 1136036..1136211 176
N° 13 1135915..1135983 69  
complement(join(1135915..1135983,1136036..1136211,1136266..1136464,1136518..1136 758,1136808..1136886,1136937..1136978,1137029..1137042,1137104..1137162,1137218. .1137226,1137279..1137295,1137353..1137372,1137423..1137466,1137520..1137627))


exon

Literature and cross-references PoCIIBA01_PC15 (MnP-short)
DNA ref. JGI genome:   scaffold_02 (1137627..1135915)
Protein sequence: PoCIIBA01_PC15 (MnP-short)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   358 (340)
PWM (Da):   %s   37766.94 (35868.9)  
PI (pH):   %s   4.77 (4.69) Peptide Signal:   %s   cut: 19 range:19-358
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFKALFTLTVLAVSAFAAPSKKVTCSGGRTTSDASCCVWFDVLDDIQENLFDGAEGEEVHESLLTFHDAIGFSPKLSRQGKFGGGGDGSLMAHTEIEAAFNANNGIDDIVEVQRPFAIKHKVSFGDFIQFAGAVGVSNCAGGPRLEFLAGRSNHSIASPDLLVPEPSDSVDAILARMGDAGFSPDEIVDLLASHSIAAADHVDESIGTPFDSTPSAFDAQFFLEVLLKGTLVPGNGTHTGQALSPIPGEIRIQSDFLLARDRRTACRWQSFIANERLMVSRFEKVMSKLATLGQVRSRLTDCSDVIPVPQVRLTKPVTIPAGRSMADVEACAATPFPALSADPGPVTTVPPV*

Retrieve as FASTA  
Remarks Complete sequence from genomic (12 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTTCAAAGCTCTCTTCACTCTTACCGTGCTTGCCGTGTCCGCCTTTGCCGCTCCATCCAAGAAGGTCACTTGCAGCGGTGGAAGGACGACTAGCGATGCCAGCGTAGGTTAAAGT
TGGTTATGGCACTAACATGGCCGCTGACTGAGCAGCGATAGTGTTGCGTCTGGTTCGACGTCCTGGACGACATTCAAGAGAACCTGTGGGTCTAAAATACCCTGCGTTTTCTGTGGTTAT
TAACGTTGGTCATAGATTTGACGGTGCTGAGTGTGGCAAGTTAACTTGCTCATTTACGGTAGTCTCTTTTTTCTAACTCTTCAGAATTGCAGGCGAAGAAGTGCACGAGGTACGTTGATA
AGATATTGTCCACTTTCCACAACTAATTGCATTGTCCATAGTCCCTTCGCGTGAGCTTTTCTGTTAAATCCGGACTGACCGGGCTATTCACAACGCCCCCATTAGTTGACGTTCCATGAT
GCTATCGGATTCTCCCCGAAGCTATCCCGCCAAGGAAAGTTCGG
GTAAGTGCACATGCCGTACTTTCTTTATCCACTAATCTCATCTCTTTGGGTAACTCAATAGTGGTGGAGGCGCGGG
TAGGACACTCATAGCCTAGCACATGCTCCACATTTTGACATCTTCGCAGACGGTTCTCTCATGGCACATACGGAGATCGAGGCGGCCTTCAGCAAGTGCTTTCCCCTTGGTAAACACTTG
CAGTCTAACACGGTCACGTAGATGCAAACAACGGTATCGATGACATCGTCGAGGTCCAGAGGCCCTTCGCCATCAAGCATAAAGTATCCTTTGGTGACTTGTAAGTTGCACCGCAGTGCT
CCATGGCGCAACTGCTAATTGTAAAATAGCATCCAATTTGCTGGTGCGGTTGGTGTAAGCAACTGTGCTGGAGGCCCCCGACTTGAATTCCTGGCTGGCCGTTCGAATCACTCCATCGCA
TCCCCTGACCTCCTTGTCCCCGAGCCCAGCGACTCGGTGGATGCCATATTGGCCAGAATGGGAGATGCAGGTTTCAGCCCAGACGAGATCGTTGATCTTCTTGCCTCGCACAGTATCGCA
GCAGCTGATCACGTCGATGAGAGCATCCCC
GTACGTTGTCGTCTCTTTTCAAGTAGATGTTAACCGACGCCGTCTCCTATTAGGGGACCCCGTTCGACTCTACTCCGAGCGCTTTCGATG
CGCAATTCTTCTTGGAAGTGCTTCTCAAAGGAACGCTTGTGCCAGGAAATGGCACCCACACCGGCCAGGCGCTTTCTCCTATCCCTGGTGAAATCCGCATCCAATCAGACTTCTTGCTTG
CTCGCGACAGACGCACAGCCTGCAGGTGGCAATCTTTCATTG
GTATGTTATCCATGCGCTCAGCTATTTTAGATGTGCTTAACTTTGCCATACTAGCTAATGAAAGGCTCATGGTTTCGC
GATTCGAAAAGGTCATGTCGAAGTTAGCCACCCTTGGACAAGTCCGCTCCCGCCTCACCGACTGTTCCGACGTAATCCCCGTTCCCCAAGTCCGACTCACCAAGCCCGTCACCATTCCCG
CTGGGAGAAGCATGGCTGACGTGGAAGCTGCT
GTAAGATATTCATCGTATCGCACAAGTATACCCTTTCACCCTACCTTCATAGTGTGCTGCCACCCCCTTCCCTGCTCTTTCTGCAGAT
CCCGGTCCAGTTACTACTGTTCCCCCTGTGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTTCAAAGCTCTCTTCACTCTTACCGTGCTTGCCGTGTCCGCCTTTGCCGCTCCATCCAAGAAGGTCACTTGCAGCGGTGGAAGGACGACTAGCGATGCCAGCTGTTGCGTCTGG
TTCGACGTCCTGGACGACATTCAAGAGAACCT
ATTTGACGGTGCTGAGTGTGGCGAAGAAGTGCACGAGTCCCTTCGCTTGACGTTCCATGATGCTATCGGATTCTCCCCGAAGCTATCC
CGCCAAGGAAAGTTCGG
TGGTGGAGGCGCGGACGGTTCTCTCATGGCACATACGGAGATCGAGGCGGCCTTCAATGCAAACAACGGTATCGATGACATCGTCGAGGTCCAGAGGCCCTTC
GCCATCAAGCATAAAGTATCCTTTGGTGACTT
CATCCAATTTGCTGGTGCGGTTGGTGTAAGCAACTGTGCTGGAGGCCCCCGACTTGAATTCCTGGCTGGCCGTTCGAATCACTCCATC
GCATCCCCTGACCTCCTTGTCCCCGAGCCCAGCGACTCGGTGGATGCCATATTGGCCAGAATGGGAGATGCAGGTTTCAGCCCAGACGAGATCGTTGATCTTCTTGCCTCGCACAGTATC
GCAGCAGCTGATCACGTCGATGAGAGCATCCCC
GGGACCCCGTTCGACTCTACTCCGAGCGCTTTCGATGCGCAATTCTTCTTGGAAGTGCTTCTCAAAGGAACGCTTGTGCCAGGAAAT
GGCACCCACACCGGCCAGGCGCTTTCTCCTATCCCTGGTGAAATCCGCATCCAATCAGACTTCTTGCTTGCTCGCGACAGACGCACAGCCTGCAGGTGGCAATCTTTCATTG
CTAATGAA
AGGCTCATGGTTTCGCGATTCGAAAAGGTCATGTCGAAGTTAGCCACCCTTGGACAAGTCCGCTCCCGCCTCACCGACTGTTCCGACGTAATCCCCGTTCCCCAAGTCCGACTCACCAAG
CCCGTCACCATTCCCGCTGGGAGAAGCATGGCTGACGTGGAAGCTGCT
TGTGCTGCCACCCCCTTCCCTGCTCTTTCTGCAGATCCCGGTCCAGTTACTACTGTTCCCCCTGTGTGA

Retrieve as FASTA