Entry information : PoCIIBA03_PC15 (MnP-short)
Entry ID 9846
Creation 2011-11-25 (Christophe Dunand)
Last sequence changes 2011-11-25 (Christophe Dunand)
Sequence status complete
Reviewer Nizar Fawal
Last annotation changes 2012-08-22 (Nizar Fawal)
Peroxidase information: PoCIIBA03_PC15 (MnP-short)
Name (synonym) PoCIIBA03_PC15 (MnP-short)
Class Other class II peroxidase type A    [Orthogroup: CIIBA001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Pleurotaceae Pleurotus
Organism Pleurotus ostreatus (Oyster mushroom)    [TaxId: 5322 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PoCIIBA03_PC15
start..stop
S start..stop
PoCIIBA03_C9 743 0 1..365 1..365
ParcCIIBA06 488 2e-174 20..365 15..361
ParcCIIBA04 484 6e-173 28..362 26..361
PoCIIBA02_C9 482 5e-172 25..362 20..360
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1829401..1829567 167 N° 2 1829330..1829349 20 N° 3 1829251..1829276 26 N° 4 1829134..1829192 59
N° 5 1829060..1829073 14 N° 6 1828884..1829004 121 N° 7 1828527..1828821 295 N° 8 1828365..1828471 107
N° 9 1828268..1828305 38 N° 10 1828045..1828217 173 N° 11 1827921..1827985 65 N° 12 1827850..1827862 13
complement(join(1827850..1827862,1827921..1827985,1828045..1828217,1828268..1828 305,1828365..1828471,1828527..1828821,1828884..1829004,1829060..1829073,1829134. .1829192,1829251..1829276,1829330..1829349,1829401..1829567))


exon

Literature and cross-references PoCIIBA03_PC15 (MnP-short)
DNA ref. JGI genome:   scaffold_01 (1829567..1827850)
Protein sequence: PoCIIBA03_PC15 (MnP-short)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   366 (342)
PWM (Da):   %s   39092.76 (36628.4) Transmb domain:   %s   i5-27o
PI (pH):   %s   6.04 (5.87) Peptide Signal:   %s   cut: 24 range:24-365
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVNSFHSLLSTIALALLVPSVLAVPAHRAKCSKGRTASNDACCVWFDVLDDIQENLFDGGECGEEVHESLRLTFHDAIGFSPALTRQGKFGGGGADGSIMLFSDIETNFAANNGVDDIVEQQKPIAIKHQVSFGDFIQFAGAVGSSNCAGGPRIQFLAGRSNVTKPSPDHLVPEPFDSVTSILARMGDAGFKPDEVVALLASHSVAAQDTIDPKLAGHPFDSTPSDFDSQFFVETLLKGTLIPGDSLHKGQVKSPLPGEFRLQSDELLARDSRTSCEWQSFISNPNSMVPKFERAMAKMATLGQNPKKLIDCSEVIPVPRGRVKQPTLPAGKTIKDIEASCRKAPFPRLPTDKGTFTSILPVPSS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (11 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCAACTCATTCCACTCACTCTTGAGCACCATTGCTCTTGCTCTGCTGGTCCCTTCGGTTCTCGCCGTCCCAGCTCACCGCGCAAAATGCAGCAAGGGAAGGACAGCAAGCAATGAC
GCGTGCTGTGTGTGGTTCGATGTCCTCGATGACATCCAAGAGAACCT
GTGAGATATGCATATTACCTGTGTTTATTGCTGTCTAACCTTGGTCAACAGCTTTGACGGCGGAGAGTGCGGT
ATGCACCTTGTCAATCCATTGGCACAGCCGTATACTGACTTCTGACTTCAGGCGAAGAGGTCCACGAATCCTTGAGGGTATGGCAAATGACTCCTCTGTTGTATCGAGATTCGACGCTTA
TACTATGTGGTATAGCTGACGTTCCACGACGCCATCGGATTCTCGCCTGCCCTGACTAGACAAGGCAAATTCGGGTCAGTATTCTCTTTCCAATAGTGATGTTGTCCATTTATTGAGGTG
TGGTTTCTGAACAGTGGCGGCGGCGCTGGTAAGACTCAATGAATCTCGGTCCATGATCAACACTAACGAGATATGTTGAAAAGACGGATCCATCATGCTCTTCTCAGACATTGAGACTAA
TTTCGCGGCCAACAATGGTGTTGATGACATTGTCGAGCAGCAAAAGCCGATCGCCATCAAACACCAGGTCTCGTTCGGTGATTT
GTATGTACTGCTCATCGGCTGTTTGACATATCGGCT
ATATGAAACTGATATGTCTCCCGCAGCATCCAGTTCGCAGGCGCTGTTGGCTCGTCCAACTGCGCCGGAGGGCCACGTATCCAGTTTTTGGCGGGTCGCTCTAATGTCACGAAGCCGTCC
CCCGACCACTTGGTGCCCGAGCCCTTTGATTCTGTTACCAGTATCCTTGCCCGCATGGGAGATGCTGGATTTAAGCCTGATGAAGTCGTTGCTTTGCTAGCCTCGCACTCCGTCGCAGCT
CAGGATACTATCGACCCCAAGCTTGCTGGGCACCCCTTTGATTCGACACCATCCGACTTTGATTCGCAGTTCTTCGTTGAG
GTTTGTCTTGATAGAATAAACTCCTTCCTTGCTGTCGGT
TGACGATGGCTTTTAGACACTTTTGAAGGGAACTCTTATTCCGGGTGACTCCCTCCACAAGGGTCAAGTCAAGTCACCCCTTCCCGGTGAATTCAGGCTCCAGTCAGACGAACTTCTCGC
AAG
GTTTGTCCTTCTCTGTAATCCCTCTGGCGTCACCCACTTACCTTCATGACCTCCTCAAGGGACTCGCGCACTTCCTGCGAATGGCAATCCTTCATCTGTGAGTACTATTTACGCTGC
CCTTCCGTTCATATTCTGATGATTCGCCAGCCAACCCCAACTCGATGGTACCTAAATTCGAGAGGGCAATGGCCAAGATGGCGACCCTCGGACAGAACCCAAAGAAGCTGATTGACTGCT
CAGAAGTCATCCCAGTTCCCCGTGGTCGCGTCAAGCAGCCTACCCTCCCCGCTGGCAAGACCATCAAGGATATTGAAGCATCC
GTAAGCTCTCTTCGCAATGTCTATTTTTCTCTGTCGT
GCCATGCTCACTCTTCATCTAGTGCCGCAAAGCGCCCTTCCCTCGGTTGCCAACTGACAAAGGCACATTCACCAGCATCCTCCCAGTGTAAGCCATCTACCCCAAGCCGTCTCAGAATGC
GCAACTTATACTCTTCCTCTTACAGTCCTAGTTCATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCAACTCATTCCACTCACTCTTGAGCACCATTGCTCTTGCTCTGCTGGTCCCTTCGGTTCTCGCCGTCCCAGCTCACCGCGCAAAATGCAGCAAGGGAAGGACAGCAAGCAATGAC
GCGTGCTGTGTGTGGTTCGATGTCCTCGATGACATCCAAGAGAACCT
CTTTGACGGCGGAGAGTGCGGCGAAGAGGTCCACGAATCCTTGAGGCTGACGTTCCACGACGCCATCGGATTC
TCGCCTGCCCTGACTAGACAAGGCAAATTCGG
TGGCGGCGGCGCTGACGGATCCATCATGCTCTTCTCAGACATTGAGACTAATTTCGCGGCCAACAATGGTGTTGATGACATTGTCGAG
CAGCAAAAGCCGATCGCCATCAAACACCAGGTCTCGTTCGGTGATTT
CATCCAGTTCGCAGGCGCTGTTGGCTCGTCCAACTGCGCCGGAGGGCCACGTATCCAGTTTTTGGCGGGTCGC
TCTAATGTCACGAAGCCGTCCCCCGACCACTTGGTGCCCGAGCCCTTTGATTCTGTTACCAGTATCCTTGCCCGCATGGGAGATGCTGGATTTAAGCCTGATGAAGTCGTTGCTTTGCTA
GCCTCGCACTCCGTCGCAGCTCAGGATACTATCGACCCCAAGCTTGCTGGGCACCCCTTTGATTCGACACCATCCGACTTTGATTCGCAGTTCTTCGTTGAG
ACACTTTTGAAGGGAACT
CTTATTCCGGGTGACTCCCTCCACAAGGGTCAAGTCAAGTCACCCCTTCCCGGTGAATTCAGGCTCCAGTCAGACGAACTTCTCGCAAG
GGACTCGCGCACTTCCTGCGAATGGCAATCC
TTCATCT
CCAACCCCAACTCGATGGTACCTAAATTCGAGAGGGCAATGGCCAAGATGGCGACCCTCGGACAGAACCCAAAGAAGCTGATTGACTGCTCAGAAGTCATCCCAGTTCCCCGT
GGTCGCGTCAAGCAGCCTACCCTCCCCGCTGGCAAGACCATCAAGGATATTGAAGCATCC
TGCCGCAAAGCGCCCTTCCCTCGGTTGCCAACTGACAAAGGCACATTCACCAGCATCCTC
CCAGT
TCCTAGTTCATAA

Retrieve as FASTA