Entry information : TvDyPrx02 (DyP2)
Entry ID 9853
Creation 2011-12-02 (Christophe Dunand)
Last sequence changes 2011-12-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-27 (Catherine Mathe (Scipio))
Peroxidase information: TvDyPrx02 (DyP2)
Name (synonym) TvDyPrx02 (DyP2)
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Trametes
Organism Trametes versicolor (Coriolus versicolor )    [TaxId: 5325 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TvDyPrx02
start..stop
S start..stop
TvDyPrx01 600 0 1..489 1..485
TvDyPrx01_other 582 0 10..489 12..486
CsuDyPrx01 563 0 6..486 9..479
HanDyPrx01 532 0 6..486 9..481
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2137219..2137265 47 N° 2 2137322..2137559 238 N° 3 2137613..2137920 308 N° 4 2137975..2138273 299
N° 5 2138341..2138614 274 N° 6 2138670..2138731 62 N° 7 2138800..2139041 242  
join(2137219..2137265,2137322..2137559,2137613..2137920,2137975..2138273,2138341 ..2138614,2138670..2138731,2138800..2139041)


exon

Literature and cross-references TvDyPrx02 (DyP2)
DNA ref. JGI genome:   scaffold_7 (2137219..2139041)
Protein sequence: TvDyPrx02 (DyP2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   489
PWM (Da):   %s   52514.69  
PI (pH):   %s   5.58
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSDALNFDDIQGDILVGLPKRVQQYIIFQIGSNVAGFKQALTQLLPLITTTTQAMQNRAAIAANKKAAQEQGKTPELLKMSGVNIAFSHVGLALGINDNIHDDLFTNGQQADAQSLGDPGTSSGFPISHFTPSWDPAFLNKTHGVIIIAGDSDDTVASVRKQVEAIFNVGGFNATLSEVITLSGSVRPGDQKGHEHFGFMDGISQPAVQGVDTSPNPGQDTVHQGVILCKRDNDNTSLLRPAWAKDGSFLVLRYLFQLVPEFNVFLQSNPIKEASLTPEQGSELLGARLMGRWKGAPVDIAPFQDDPVLAADPLRNNNFNYTAENDNRGANCPLAAHTRKGNPRHDLQDMPIPIPLEPHRIIRRGIPFGPEVTADEAASGKTNQSRGLIFVCYQSNLADGFTFIQTWANQPLFPLKGLAPPVPVPGFDAIIGQATDETSRTIAGTDPLNSTGTLHLPTEWVVPRGGEYFFSPSLPALRSTFAQAS

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCCGACGCGCTCAACTTTGACGACATCCAAGGCGATATTCTGTAAGATTTCCTTCGCTGTCTCTCGATGCCGAGCTCATCCTTGACGATCTTTACAGCGTTGGTCTGCCGAAGA
GGGTGCAACAGTATATCATTTTCCAGATTGGCAGCAATGTCGCCGGGTTCAAACAGGCCCTCACGCAGCTCCTCCCGCTCATCACTACGACCACCCAGGCTATGCAGAACCGCGCCGCCA
TTGCGGCTAATAAGAAAGCAGCGCAGGAGCAGGGCAAGACCCCTGAGCTCCTTAAGATGAGCGGCGTGAACATCGCCTTTTCTCATGTTGGCCTTGCCGCG
GTGAGCAATTTGTATAACA
CGTAATGTAGCTGTCATTGACGTATACATGGAAGCTGGGTATCAACGACAACATCCACGACGACCTCTTTACGAACGGCCAGCAGGCAGACGCCCAGTCCCTCGGCGACCCTGGCACAAG
CTCGGGATTCCCTATCAGCCACTTCACGCCCAGCTGGGACCCTGCATTCTTGAACAAAACCCACGGCGTGATCATCATCGCCGGCGACTCCGACGACACAGTGGCGAGCGTCCGCAAGCA
GGTCGAGGCCATTTTCAATGTCGGCGGATTTAACGCTACTCTGAGCGAGGTGATCACCCTCAGCGGGTCTGTGCGCCCCGGAGACCAGAAGGGCCACGAGCA
GTGAGTACACGTGAATGC
CTTGTGTCGCCGCCGTGCTGATTACTGGTGCGCCAGCTTCGGTTTCATGGACGGCATCTCGCAGCCCGCCGTCCAGGGCGTCGACACGTCCCCGAACCCCGGGCAGGACACCGTCCACCA
GGGGGTCATCCTGTGCAAACGCGACAACGACAATACCAGTTTGCTCCGCCCGGCTTGGGCGAAGGACGGGAGCTTCTTGGTCCTGCGCTACCTCTTCCAGCTTGTCCCAGAGTTCAACGT
CTTCCTGCAAAGCAACCCCATCAAGGAGGCCTCCCTCACGCCCGAGCAAGGCAGCGAGCTGCTCGGCGCCCGCCTCATGGGACGATGGAAGAGCG
GTACGGGTGTCTTCCGCGCCGAACT
CCCTCGCTACTTTTTCTGATAGTGTGCGCGGGTGATTCTTAGGTGCCCCAGTCGACATCGCTCCCTTCCAAGACGACCCGGTGTTGGCCGCAGACCCCCTGCGCAACAACAACTTCAACT
ACACCGCCGAGAACGACAACCGCGGGGCCAATTGCCCGCTCGCGGCGCACACGCGCAAGGGGAACCCGCGCCACGATCTTCAGGACATGCCCATCCCGATTCCGCTCGAGCCGCACCGCA
TCATCCGCCGCGGTATCCCGTTCGGACCTGAGGTTACTGCAGACGAGGCTGCTTCCGGAAAGACTAACCAGTCGCG
GTACGTGCGCCTTGCCAGGACGCTCAGTGCAACATTCTGACTAT
GTCTGCTACAGTGGGCTCATCTTCGTCTGCTACCAGAGCAACCTCGCCGACGGATTCACGTTCATTCAGAAGAGTGCGTCATCTTTCACACCGCCTCGCCCGCGCATCCTATATATCAGA
TCTGACGCTCTGTGCACACAGCTTGGGCGAACCAGCCTCTGTTCCCGCTGAAGGGCCTGGCCCCGCCCGTCCCCGTCCCCGGCTTCGATGCGATCATCGGGCAGGCTACGGACGAGACGT
CGCGCACCATTGCGGGCACGGACCCGCTCAACTCGACGGGCACCCTCCACCTGCCCACGGAGTGGGTCGTCCCGCGGGGCGGCGAGTACTTCTTCTCGCCCTCACTCCCGGCCCTCCGGT
CCACGTTCGCCCAGGCGTCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCCGACGCGCTCAACTTTGACGACATCCAAGGCGATATTCTCGTTGGTCTGCCGAAGAGGGTGCAACAGTATATCATTTTCCAGATTGGCAGCAATGTCGCCGGGTTCAAACAG
GCCCTCACGCAGCTCCTCCCGCTCATCACTACGACCACCCAGGCTATGCAGAACCGCGCCGCCATTGCGGCTAATAAGAAAGCAGCGCAGGAGCAGGGCAAGACCCCTGAGCTCCTTAAG
ATGAGCGGCGTGAACATCGCCTTTTCTCATGTTGGCCTTGCCGCG
CTGGGTATCAACGACAACATCCACGACGACCTCTTTACGAACGGCCAGCAGGCAGACGCCCAGTCCCTCGGCGAC
CCTGGCACAAGCTCGGGATTCCCTATCAGCCACTTCACGCCCAGCTGGGACCCTGCATTCTTGAACAAAACCCACGGCGTGATCATCATCGCCGGCGACTCCGACGACACAGTGGCGAGC
GTCCGCAAGCAGGTCGAGGCCATTTTCAATGTCGGCGGATTTAACGCTACTCTGAGCGAGGTGATCACCCTCAGCGGGTCTGTGCGCCCCGGAGACCAGAAGGGCCACGAGCA
CTTCGGT
TTCATGGACGGCATCTCGCAGCCCGCCGTCCAGGGCGTCGACACGTCCCCGAACCCCGGGCAGGACACCGTCCACCAGGGGGTCATCCTGTGCAAACGCGACAACGACAATACCAGTTTG
CTCCGCCCGGCTTGGGCGAAGGACGGGAGCTTCTTGGTCCTGCGCTACCTCTTCCAGCTTGTCCCAGAGTTCAACGTCTTCCTGCAAAGCAACCCCATCAAGGAGGCCTCCCTCACGCCC
GAGCAAGGCAGCGAGCTGCTCGGCGCCCGCCTCATGGGACGATGGAAGAGCG
GTGCCCCAGTCGACATCGCTCCCTTCCAAGACGACCCGGTGTTGGCCGCAGACCCCCTGCGCAACAAC
AACTTCAACTACACCGCCGAGAACGACAACCGCGGGGCCAATTGCCCGCTCGCGGCGCACACGCGCAAGGGGAACCCGCGCCACGATCTTCAGGACATGCCCATCCCGATTCCGCTCGAG
CCGCACCGCATCATCCGCCGCGGTATCCCGTTCGGACCTGAGGTTACTGCAGACGAGGCTGCTTCCGGAAAGACTAACCAGTCGCG
TGGGCTCATCTTCGTCTGCTACCAGAGCAACCTC
GCCGACGGATTCACGTTCATTCAGAAGA
CTTGGGCGAACCAGCCTCTGTTCCCGCTGAAGGGCCTGGCCCCGCCCGTCCCCGTCCCCGGCTTCGATGCGATCATCGGGCAGGCTACGGAC
GAGACGTCGCGCACCATTGCGGGCACGGACCCGCTCAACTCGACGGGCACCCTCCACCTGCCCACGGAGTGGGTCGTCCCGCGGGGCGGCGAGTACTTCTTCTCGCCCTCACTCCCGGCC
CTCCGGTCCACGTTCGCCCAGGCGTCTTGA

Retrieve as FASTA