Entry information : HanDyPrx01 (dpx1)
Entry ID 9854
Creation 2011-12-02 (Christophe Dunand)
Last sequence changes 2011-12-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-23 (Catherine Mathe (Scipio))
Peroxidase information: HanDyPrx01 (dpx1)
Name (synonym) HanDyPrx01 (dpx1)
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Bondarzewiaceae Heterobasidion
Organism Heterobasidion annosum (root rot fungus)    [TaxId: 13563 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HanDyPrx01
start..stop
S start..stop
ShirDyPrx02 652 0 2..487 4..491
CsuDyPrx01 631 0 1..482 1..480
TvDyPrx01 595 0 1..482 1..483
TvDyPrx01_other 589 0 8..484 7..486
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 697264..697319 56 N° 2 697382..697616 235 N° 3 697672..697973 302 N° 4 698031..698329 299
N° 5 698389..698721 333 N° 6 698777..699018 242  
join(697264..697319,697382..697616,697672..697973,698031..698329,698389..698721, 698777..699018)


exon

Literature and cross-references HanDyPrx01 (dpx1)
DNA ref. JGI genome:   scaffold_04 (697264..699018)
Protein sequence: HanDyPrx01 (dpx1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   490
PWM (Da):   %s   53432.44  
PI (pH):   %s   7.38
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTTHTPAPLNLANVQGDILAGLPKKTQTYVLFEITDAQAFRTALTHLIPLITSTEQVKKDRHSIDENKKTAAHSGHPPPLLDIVGVNVSFSQLGLNKLGIKDDIKDAVFKAGQLSDAQNLGDPGTTNASKKFVPDWIDAFKKGVHGVFIVSGSCHELVSKKVEEIEHIFGVHGHHASYTQLLSIVGDVRPGKEKGHEHFGFLDGISQPAVKGIDTDPNPGQETIRQGIMLLGRDGDDVAAQRPSWALDGSFLAFRYLFQLVPEFNKFLHDNPIDLPGLTRAEGSELLGARFMGRWKSGAPIDISPLKDDPALATDPKKNNNFRFQGEANSQTRCPFSAHVRKTNPRADLEDTKPPNSTENRRIIRRGVQFGPELTAEEQHANKTIHGRGLIFAAYQANIANGFQFIQHSWANNQKFIFGTTVEPGFDPIIGQAGSDGARTVSGSNPKAQANMLTLPTQWVVPKGGEYFFSPSIPALRDTFALGVHIESY*

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTACCCATACTCCCGCCCCACTCAATCTCGCCAACGTCCAAGGCGACATTTTGTACGTATATATACGGATGATTTATACCACTGGCACATTGACTGACTGCATGACCTCTTAAGGG
CTGGATTGCCAAAGAAGACCCAGACCTACGTCTTATTCGAGATTACGGATGCCCAGGCATTCCGTACCGCCCTCACTCATCTGATACCCCTCATCACGTCAACTGAGCAGGTCAAGAAGG
ATCGCCATTCGATTGATGAGAACAAGAAGACAGCAGCTCACAGCGGCCATCCGCCTCCACTCTTGGACATAGTCGGCGTGAACGTTTCATTCTCTCAACTCGGGTTGAACAAG
GTTTGTA
ATTCCTACAACAACCCAACTGGCTTTTGATAACCTTCATTTGTTCTAGCTTGGGATTAAAGATGATATCAAAGACGCGGTATTCAAGGCTGGACAGCTCAGTGACGCTCAAAACCTAGGC
GACCCCGGGACCACAAACGCATCGAAGAAGTTTGTTCCTGACTGGATTGATGCTTTCAAGAAGGGTGTACATGGCGTCTTCATCGTGTCTGGCTCTTGCCACGAGTTGGTGAGCAAGAAG
GTTGAGGAGATCGAGCATATCTTTGGTGTACACGGGCACCACGCGAGCTACACCCAACTCTTGTCAATTGTTGGGGATGTCCGACCTGGCAAAGAGAAAGGTCACGAACA
GTAAGTCAAT
CAACCACCCCAATCTGCCTGTGCGTTTGACTTTTGACCCGTTTATAGCTTTGGTTTCTTGGATGGTATCTCACAGCCCGCCGTTAAAGGAATTGATACCGACCCGAACCCCGGCCAAGAG
ACAATTCGCCAAGGCATCATGCTCCTGGGACGTGATGGTGATGACGTTGCAGCACAGCGCCCATCGTGGGCATTGGACGGCAGTTTCCTCGCCTTCAGATACCTTTTCCAGCTTGTTCCC
GAGTTCAACAAATTCCTGCACGACAACCCTATCGACCTTCCGGGTTTGACCCGTGCAGAAGGTAGCGAGCTTCTTGGCGCGCGGTTCATGGGAAGGTGGAAGAGCG
GTAAGTTTGTCAAC
ATAGCTAGAGCATCCATGGAAGACTAACGTGGACTTTCTCCCCAGGTGCCCCCATCGATATCTCTCCTCTCAAGGACGATCCTGCCCTCGCCACGGACCCGAAGAAGAACAACAACTTCC
GTTTCCAAGGAGAGGCCAACAGCCAGACCCGATGCCCATTCTCTGCCCACGTCCGCAAGACGAACCCCCGTGCGGATCTCGAGGACACTAAGCCCCCTAATAGCACCGAGAATCGCAGGA
TCATTCGCAGAGGCGTTCAGTTTGGCCCTGAACTCACCGCGGAGGAGCAGCACGCAAACAAGACAATCCACGGGCGGGGTCTTATCTTTGCCGCTTATCAAGCTAACATCGCTAATGGCT
TCCAGTTCATTCAGCACA
GTATGCATCTTCATTTCATTTAATTTATTCATGATACTCATGATATTCTCTCAAGGCTGGGCGAACAACCAGAAATTCATTTTTGGAACGACTGTGGAGCCT
GGCTTTGACCCCATCATCGGGCAAGCTGGCTCTGACGGAGCCCGCACGGTGTCAGGCTCTAACCCCAAAGCTCAGGCCAATATGCTCACATTGCCGACTCAATGGGTTGTGCCCAAGGGA
GGAGAGTACTTCTTCTCGCCCTCGATCCCGGCCCTGCGTGACACTTTTGCGCTCGGCGTTCACATCGAATCTTAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTACCCATACTCCCGCCCCACTCAATCTCGCCAACGTCCAAGGCGACATTTTGGCTGGATTGCCAAAGAAGACCCAGACCTACGTCTTATTCGAGATTACGGATGCCCAGGCATTC
CGTACCGCCCTCACTCATCTGATACCCCTCATCACGTCAACTGAGCAGGTCAAGAAGGATCGCCATTCGATTGATGAGAACAAGAAGACAGCAGCTCACAGCGGCCATCCGCCTCCACTC
TTGGACATAGTCGGCGTGAACGTTTCATTCTCTCAACTCGGGTTGAACAAG
CTTGGGATTAAAGATGATATCAAAGACGCGGTATTCAAGGCTGGACAGCTCAGTGACGCTCAAAACCTA
GGCGACCCCGGGACCACAAACGCATCGAAGAAGTTTGTTCCTGACTGGATTGATGCTTTCAAGAAGGGTGTACATGGCGTCTTCATCGTGTCTGGCTCTTGCCACGAGTTGGTGAGCAAG
AAGGTTGAGGAGATCGAGCATATCTTTGGTGTACACGGGCACCACGCGAGCTACACCCAACTCTTGTCAATTGTTGGGGATGTCCGACCTGGCAAAGAGAAAGGTCACGAACA
CTTTGGT
TTCTTGGATGGTATCTCACAGCCCGCCGTTAAAGGAATTGATACCGACCCGAACCCCGGCCAAGAGACAATTCGCCAAGGCATCATGCTCCTGGGACGTGATGGTGATGACGTTGCAGCA
CAGCGCCCATCGTGGGCATTGGACGGCAGTTTCCTCGCCTTCAGATACCTTTTCCAGCTTGTTCCCGAGTTCAACAAATTCCTGCACGACAACCCTATCGACCTTCCGGGTTTGACCCGT
GCAGAAGGTAGCGAGCTTCTTGGCGCGCGGTTCATGGGAAGGTGGAAGAGCG
GTGCCCCCATCGATATCTCTCCTCTCAAGGACGATCCTGCCCTCGCCACGGACCCGAAGAAGAACAAC
AACTTCCGTTTCCAAGGAGAGGCCAACAGCCAGACCCGATGCCCATTCTCTGCCCACGTCCGCAAGACGAACCCCCGTGCGGATCTCGAGGACACTAAGCCCCCTAATAGCACCGAGAAT
CGCAGGATCATTCGCAGAGGCGTTCAGTTTGGCCCTGAACTCACCGCGGAGGAGCAGCACGCAAACAAGACAATCCACGGGCGGGGTCTTATCTTTGCCGCTTATCAAGCTAACATCGCT
AATGGCTTCCAGTTCATTCAGCACA
GCTGGGCGAACAACCAGAAATTCATTTTTGGAACGACTGTGGAGCCTGGCTTTGACCCCATCATCGGGCAAGCTGGCTCTGACGGAGCCCGCACG
GTGTCAGGCTCTAACCCCAAAGCTCAGGCCAATATGCTCACATTGCCGACTCAATGGGTTGTGCCCAAGGGAGGAGAGTACTTCTTCTCGCCCTCGATCCCGGCCCTGCGTGACACTTTT
GCGCTCGGCGTTCACATCGAATCTTAC

Retrieve as FASTA