Entry information : GmPrx320
Entry ID 9857
Creation 2011-11-29 (Qiang Li)
Last sequence changes 2011-12-02 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-14 (Christophe Dunand)
Peroxidase information: GmPrx320
Name GmPrx320
Class Class III peroxidase    [Orthogroup: Prx005]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx320
start..stop
S start..stop
MtPrx66 573 0 1..320 1..320
LjPrx51 545 0 4..320 5..322
GmPrx79 545 0 5..320 6..321
RcPrx09 535 0 5..320 6..321
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 26988399..26988596 198 N° 2 26988885..26989064 180 N° 3 26989174..26989336 163 N° 4 26989610..26990031 422
join(26988399..26988596,26988885..26989064,26989174..26989336,26989610..26990031 )


exon

Literature and cross-references GmPrx320
DNA ref. Phytozome 11:   Gm13 (26988399..26990031)
Protein sequence: GmPrx320
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   320 (301)
PWM (Da):   %s   34410.43 (32465.4)  
PI (pH):   %s   6.04 (6.35) Peptide Signal:   %s   cut: 20 range:20-320
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDAILGSLMILVMTSAVQAQLKTGFYSTSCPNAEAIVRSTVVSHFSKDLSIAPGLLRLHFHDCFVQGCDGSILIADSSAEKNALPNIGLRGFEVIDDAKSQIEAICPGIVSCADILALAARDAVDLSDGPSWPVPTGRRDGRISLSSQASNMPSPLDSVSVQRQKFAAKGLDDHDLVTLVGAHTIGQTECRFFSYRLYNFTTSGSADPTINVAFLAQLQALCPKNGDGLRRVALDKDSPAKFDVSFFKNVRDGNGVLESDQRLWEDSATQSVVQNYAGNVRGFLGLRFDFEFPKAMIKLSSVEVKIGTDGEIRKVCSKFN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATGCCATATTGGGTTCCCTAATGATTTTAGTGATGACTTCAGCAGTACAAGCCCAATTGAAAACTGGGTTTTATTCTACTTCATGTCCAAATGCTGAGGCAATAGTACGGTCCACC
GTTGTATCCCACTTCAGCAAGGATCTATCCATTGCTCCTGGCCTGCTCAGGCTTCATTTCCATGATTGCTTTGTCCAG
GTAAGCTAATCTCAATCTCAAATCCTTCACTCACGTAAAGCC
GTAAATGTATAAAAGAGGTGTATGAACACATAAAAAATGAGAAACTATACATCAAGATTAAAAGTGACCAACATATATATCTTAGTAACAGACTATGAATTTTTAACATTTGTTCTCTTA
ATTTTCTAATTAACAATTATAATTTCACTTCACTTACTTCATAGTCGTCAAGTCAGGTCTTAATTTCTTTTCGTAGAATTTTATTATTTCAGACTCATGAACGTCATTTGACATTTTCTC
CCACAGGGATGCGATGGTTCAATTTTAATTGCAGACTCTTCTGCAGAGAAGAATGCATTGCCAAACATTGGTCTAAGAGGTTTTGAAGTGATCGATGACGCAAAATCACAAATAGAGGCC
ATATGTCCTGGAATTGTCTCATGTGCTGACATCCTAGCATTAGCAGCTCGTGATGCTGTCGATTTG
GTATTAAGATAAACTCTTTAAACTTCATCAAATACACTCTAGCACTAGCACACA
CACTTGGCCTTTTTGAAGGAATAGATAAAATTAACACTAATGAAAATAATGGCAGAGTGATGGCCCAAGTTGGCCAGTACCCACAGGAAGAAGAGATGGGAGGATTTCTTTATCATCTCA
AGCCTCAAATATGCCTTCACCACTTGACTCAGTTTCAGTCCAGAGGCAAAAATTTGCGGCGAAAGGTCTAGATGATCATGATCTTGTCACGTTAGTTG
GTATGCTTTCTCTCGTAGTATT
TAATGAAAGAAAAATGTTAATAACACACTTTTTTAAATACATATTTTATTTANNNNNNNNNNNNNNNNNNNNNNNNNNTTGTAATATTTTATGAGTTCTATTCATGATTTCATAAGAATA
TGTTAGAAAAAGGAGGTGTTAAGAGAGTGTGTTATTGGTACTCTTATTAATGAAAGTGTGTGAAATATTTATGTTACTAGTATCTGAATACAACAATTTATGTTATGCATGTCTTATTTA
TGTGTCTTAAGGTGCACATACTATAGGCCAGACAGAATGCAGGTTCTTCAGCTATCGTCTATACAATTTCACCACCTCTGGTAGTGCTGATCCCACTATAAACGTAGCTTTCTTAGCTCA
ACTTCAAGCACTTTGTCCAAAAAATGGAGATGGCTTGAGAAGGGTGGCCTTGGACAAAGATAGCCCAGCCAAATTTGATGTTAGTTTCTTCAAGAATGTACGTGATGGTAATGGGGTTCT
TGAGTCAGACCAGAGGTTGTGGGAAGATTCTGCTACTCAAAGTGTGGTGCAAAATTATGCTGGGAATGTTAGAGGGTTTCTGGGGTTGAGATTTGACTTTGAATTTCCAAAGGCTATGAT
TAAGTTAAGCAGTGTAGAGGTGAAGATTGGTACTGATGGAGAGATCAGAAAAGTGTGTTCAAAATTTAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATGCCATATTGGGTTCCCTAATGATTTTAGTGATGACTTCAGCAGTACAAGCCCAATTGAAAACTGGGTTTTATTCTACTTCATGTCCAAATGCTGAGGCAATAGTACGGTCCACC
GTTGTATCCCACTTCAGCAAGGATCTATCCATTGCTCCTGGCCTGCTCAGGCTTCATTTCCATGATTGCTTTGTCCAG
GGATGCGATGGTTCAATTTTAATTGCAGACTCTTCTGCAGAG
AAGAATGCATTGCCAAACATTGGTCTAAGAGGTTTTGAAGTGATCGATGACGCAAAATCACAAATAGAGGCCATATGTCCTGGAATTGTCTCATGTGCTGACATCCTAGCATTAGCAGCT
CGTGATGCTGTCGATTTG
AGTGATGGCCCAAGTTGGCCAGTACCCACAGGAAGAAGAGATGGGAGGATTTCTTTATCATCTCAAGCCTCAAATATGCCTTCACCACTTGACTCAGTTTCA
GTCCAGAGGCAAAAATTTGCGGCGAAAGGTCTAGATGATCATGATCTTGTCACGTTAGTTG
GTGCACATACTATAGGCCAGACAGAATGCAGGTTCTTCAGCTATCGTCTATACAATTTC
ACCACCTCTGGTAGTGCTGATCCCACTATAAACGTAGCTTTCTTAGCTCAACTTCAAGCACTTTGTCCAAAAAATGGAGATGGCTTGAGAAGGGTGGCCTTGGACAAAGATAGCCCAGCC
AAATTTGATGTTAGTTTCTTCAAGAATGTACGTGATGGTAATGGGGTTCTTGAGTCAGACCAGAGGTTGTGGGAAGATTCTGCTACTCAAAGTGTGGTGCAAAATTATGCTGGGAATGTT
AGAGGGTTTCTGGGGTTGAGATTTGACTTTGAATTTCCAAAGGCTATGATTAAGTTAAGCAGTGTAGAGGTGAAGATTGGTACTGATGGAGAGATCAGAAAAGTGTGTTCAAAATTTAAT
TGA

Retrieve as FASTA