Entry information : GmAPx[P]27
Entry ID 9861
Creation 2011-11-29 (Qiang Li)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-01-12 (Christophe Dunand)
Peroxidase information: GmAPx[P]27
Name GmAPx[P]27
Class Ascorbate peroxidase     [Orthogroup: APx003]*
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmAPx[P]27
start..stop
S start..stop
GmAPx06 288 1e-99 5..196 95..280
MtAPx05 230 1e-76 5..196 95..281
CroAPx05 195 4e-64 5..193 11..198
CroAPx03 196 2e-63 5..193 96..288
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 49328690..49328776 87 N° 2 49328885..49329013 129 N° 3 49331279..49331373 95 N° 4 49331455..49331557 103
N° 5 49331666..49331837 172  
join(49328690..49328776,49328885..49329013,49331279..49331373,49331455..49331557 ,49331666..49331837)


exon

Literature and cross-references GmAPx[P]27
DNA ref. Phytozome 12:   Gm01 (49328690..49331837)
Protein sequence: GmAPx[P]27
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   196
PWM (Da):   %s   21763.31 Transmb domain:   %s   o166-188i
PI (pH):   %s   6.12
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
INLYFQLAGVVPVEVTGGPTMDFVPGRKVDSLESPVEGCLPDAEQGKLWLVSSPLFFFYHIPSLDKNYFATSALIDKGKAHKDRSDFHGQWTKDPLKFDNSYFVELLRGESKDLLKLPTDKALVEDPNFRKYVELYAKDEDAFFADYATSYKxxNSELGFIFRNHRSILAKGVTGIAIVLTAVILGYLRELNKITN

Retrieve as FASTA  
Remarks Pseudogene from genomic (5' end is missing, stop in frame). No prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATTAACTTGTATTTTCAGCTAGCTGGTGTTGTTCCAGTAGAGGTCACTGGGGGTCCAACTATGGACTTTGTTCCAGGGAGAAAAGTATGTTTCATGCGCAAGTTTTGTTTAGCCTCGTAC
TAATTCATATATATGTTTCGATTTTCGATACATTATCTTTAGATTTACTATTACTTTTCTTTATTGTTATCCTAGGATTCATTGGAATCTCCAGTAGAAGGGTGTCTTCCGGATGCCGAA
CAAGGTAAACTGTGGCTTGTTTCGTCTCCACTTTTTTTTTTCTACCATATTCCATCCCTGGATAAAAACTATTTTGCGACATCA
CTTTTAATTTATAATAATACTCCCTTATATAAAATG
TCACACTATTTAGGAAAATAATCTTTGGACACTTAGATGCAAGAGGGAGAAATGAGAAATTAAGCAAAATAAATTATTTTTAATGAATATAAAATGAAGCGTTATCCAATAACATGGTTA
TCTAAAAAGTAAACGTGAAAAACTCTCCCATAGGTTGGCTTTGCTGTTCAATGTTACCATTTTACAAGAGTTAGAATTTCGGAATCCGCTTGTCGATCGCATAAATAGCCATTTCATTAC
CCTAAACGTTGTTCACTAGTTGCTAGCTTTGACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTGCGGTGAAACTTC
GACAAAAGCTTTTGGAGTACCCAAAAAGCCATGAATAGGAACAATTTTTTTATGTATATAATTAAGGGGAGCTAACGCCGCAGAAATTAAAATAAAGATGAGAAGTTTTGAGTATGAAAA
ATGAAAACACATGAAAACAACAAAATTAATGAAGTTAGCTGAGGCTTAAGAAGAGAATCACCCTTGAATATATACACTTGAGACAGAAAAGCCTAGAAAAGCCTCCTTGAACAGGTTATT
TTTAAGCAAAAATGTCTTCAGTTTTTAATAATTATATACACACACATATAAAATAGTTGAAAAGTTTAGAAAACATGTATCGTAAAGAATTCCACTAAGCTGTGTGTATAGCATATAAAA
GATAAATAGTCAACAAAAATTGATAGAGAGAGAAATAGAAAGTGTAAGATAAAATGAATATAATAATTAGAAATAAAGAAAAATACAAAATATTGTAGAAAGTCTGTATAAAATACAAAA
TCAGAAAATAGGATGAAATAAATCATAATTTTATCTTAATAAGATTTTTTTTTCTAATATAAAGTTTTAAAGTCTTTTGACAAAAGCTGAATATATATTTCATACTATTTTTTGAGTAAG
ATTTTGTCTATTCTATACACCATGATTATTCATCATTTATCAATTGTTTGATAGAACTTTTGNNNNNNNNNNNNNNNNNNNNNNNAATGATTTTATTTGCCCATGCATGCTTGTTGCTAT
ATATTTCGATTATATATGCTCTTCTTTTCTTTTGTAATTTGATTTTTGTAAAAACATTCATTAATTTCTTTTTTTTAAAAAAATCATTAATTAATGCCCATGGTCTTCTTTGTAGCAATT
GTGTATTTTTGTTTAACCTTACCCAAAGTATTAGTAAATTTATAGCAATTGTGTATTTTTGTTTAACCTTATCCAAGAGTCAGAGTAAGTATTTAAATTTATTTTCAACCCCCTTGATTA
CTTTAAAATCTAACGGTGTCAAATAAAAGAGAATTTTATCCAATGTGTCTTCTCCCTTCCCTCCTCTGTCGATTCCTTTTCCTTGCCATATGCAACATGAAAAATAGGGCAATTGGATTT
ACATGAGAGAAAGAGAAGAACTGTGATTCTGGGTTCTGCGGCATTTTTAGAATGTAATCAGAATTAAGATGCAATTTCCCACGTGTAATTTGTCCCACCATGATTGGTTATTTCTTGCGG
CATGACTCTGGTTTTGCAAGTCTGAATGCAGCTTAGTCCACTTAGGCTCATTCTTTAAAATCTTGAGTCAAGCATTTTCTTGTGTAAGATTGAGTTTTTGTCCTATTAAAAAACGCAGCA
ATCAAACCTAAGTCAGACCCTTTTAACAAGATTGAATGTTTTTATTGATACATATATTATTAAAAAAAAATCCAACTAGCAGTTTTGCAATGGTATAAATTTATCAAAAATAAGATAGCA
ATACAAAAGCAAACACATTATTGATGTATAAGATGCATGAGATTGTGTTTTCGTGGCCTTCACCTGTTGGAAAGACGAATAAAAAGTTGGTTCAATTTCATTTTGTAAATTAGATGACAA
GGAAAAGGAAAGAAGTGTAGGGCATCTTTGGTGTTGGCAAGGAAAAAGAAAACAACAAAGGAGGAGGGAGAAGGGAAATGGCAAGGAAAAAGGAAATAACAGGAGGGAGAAGACGTGAGA
TAAAATTCCCTTTTATTTGACACTGTTAGATTTTAAAATAATCTAAGGGTGAGGATTGAGAGTAAGTTTAAACATTTACTTAGTGAATCCCTTCCTATCCGGAGGTCACACTTTGGTAAA
ATCAATATTACATCCAAGAGTTCTTTAATTGGTATATAGTTAAAGTATACACTTAATCTCATCACATTCGCTTTAATTGATAAGGGTAAGGCACATAAAGATCGTTCTGACTTTCATGGT
CAATGGACAAAGGACCCTTTGAAGTTTGATAACTCCTATTTTGT
GTAAGATGTTCAATTACACGATGCCAATTGTCTGCATATTCAAAATGTATAAAAATTGAAATTTCACATAACACTA
AACAGAGAATTACTGAGAGGGGAGTCAAAAGATTTACTGAAGCTTCCCACAGACAAGGCTCTAGTTGAAGATCCTAATTTCCGCAAGTATGTTGAACTATATGCGAAGGTATAACAGACA
AAGAGCGTTGGAAACATTTCACTGCCACTATTTTTTTGTATCACAATAATAAAATGAGTTTAGGCTCACACTAATAATTTTAATTGTACTATGTAGGATGAAGATGCTTTTTTCGCAGAT
TATGCAACCTCATACAAAANNNNNAACTCAGAGCTCGGCTTCATTTTCAGGAATCATCGTTCCATATTGGCCAAGGGAGTTACAGGAATTGCTATTGTCTTAACCGCTGTGATCTTGGGT
TACTTACGTGAACTGAACAAAATAACCA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATTAACTTGTATTTTCAGCTAGCTGGTGTTGTTCCAGTAGAGGTCACTGGGGGTCCAACTATGGACTTTGTTCCAGGGAGAAAAGTAGATTCATTGGAATCTCCAGTAGAAGGGTGTCTT
CCGGATGCCGAACAAGGTAAACTGTGGCTTGTTTCGTCTCCACTTTTTTTTTTCTACCATATTCCATCCCTGGATAAAAACTATTTTGCGACATCA
GCTTTAATTGATAAGGGTAAGGCA
CATAAAGATCGTTCTGACTTTCATGGTCAATGGACAAAGGACCCTTTGAAGTTTGATAACTCCTATTTTGT
AGAATTACTGAGAGGGGAGTCAAAAGATTTACTGAAGCTTCCCACAGAC
AAGGCTCTAGTTGAAGATCCTAATTTCCGCAAGTATGTTGAACTATATGCGAAG
GATGAAGATGCTTTTTTCGCAGATTATGCAACCTCATACAAAANNNNNAACTCAGAGCTCGGCTTC
ATTTTCAGGAATCATCGTTCCATATTGGCCAAGGGAGTTACAGGAATTGCTATTGTCTTAACCGCTGTGATCTTGGGTTACTTACGTGAACTGAACAAAATAACCA

Retrieve as FASTA