Entry information : GmPrx324
Entry ID 9864
Creation 2011-11-29 (Qiang Li)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-26 (Christophe Dunand)
Peroxidase information: GmPrx324
Name GmPrx324
Class Class III peroxidase    [Orthogroup: Prx039]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx324
start..stop
S start..stop
GmPrx166 644 0 1..327 1..327
MtPrx93 520 0 1..327 1..327
EgrPrx85 432 1e-153 24..327 20..319
EglPrx85 432 2e-153 24..327 20..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 891416..891635 220 N° 2 890913..891275 363 N° 3 890437..890834 398  
complement(join(890437..890834,890913..891275,891416..891635))


exon

Literature and cross-references GmPrx324
DNA ref. Phytozome 12:   Gm17 (891635..890437)
Protein sequence: GmPrx324
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327
PWM (Da):   %s   36319.03  
PI (pH):   %s   5.63
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEISFPWILVVTVVMAMxPLSFRIKANQLSYDYYKFSCPNLESVIKSELLGIFLTDATAPAAFLRLMFHDCQVQGCDASILLDSNYLAHSHSSEMKSSRNFGIRKRETISYIKSILEEECPGQVSCADIIVLAAKESVSFSGGPHIEIPLGRKDSRTCSFHEADAKLPSPTITVDEFISIFMSKGMNIEESVSILGAHTLGIGHCFNIVGRLYDPQLGDKMDFGFEASLRLACPTEIPLTNFTFVPNDMTPVIFDNQYYRDIMMGRGLFGIDSSISRDPRTAPFVMRFAMDQNYFFKAFSSAFLKLSSTNVLTDVQGDVRRQCNQVN

Retrieve as FASTA  
Remarks Complete sequence from genomic 'introns 1 and 3). No prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GAAATATCTTTTCCTTGGATTCTGGTGGTCACAGTGGTCATGGCAATGNNNCCACTTTCATTTCGCATAAAAGCAAACCAACTTTCATACGACTACTACAAGTTTTCATGCCCAAACTTG
GAAAGCGTAATCAAGAGTGAGTTGCTAGGCATATTCTTGACAGATGCTACTGCACCAGCTGCATTTCTCAGGCTCATGTTTCATGACTGCCAAGTTCAAG
TAAATTAATGTGTTTCTAGC
TTCTCTCTTTCTTTCCCTTACTTTGTTCCTCACAGACAAACAGTGTTCTTGTTTCATTCAAGGTTTATACAAAAGCCTCACNNNNNNNNNNNNNNNNNNNNNNGTTTATTTTCATGCAAG

GATGTGATGCCTCAATTCTGTTGGATTCCAACTACCTAGCTCACAGTCACAGCTCTGAAATGAAATCTTCAAGGAACTTTGGTATCAGAAAGCGGGAAACGATCAGCTACATTAAGTCAA
TATTAGAAGAAGAATGTCCGGGCCAGGTTTCTTGTGCAGATATTATTGTATTAGCTGCTAAGGAATCAGTGTCATTCTCTGGAGGACCTCATATTGAGATCCCACTTGGAAGAAAAGATT
CCAGAACTTGTAGTTTCCATGAGGCTGATGCTAAGCTTCCTTCACCAACAATAACGGTTGATGAATTTATATCGATTTTCATGTCTAAAGGAATGAACATTGAAGAGTCTGTATCCATTT
TAG
GTAATGCTAATGCATGTCAGCCTTAAAGAAGGTGTTTAAAACTGTTAACTATTGGTTATTGATTGTAACTATTGGTAGGTGCACATACACTAGGGATTGGACACTGCTTCAACATTG
TTGGTAGATTGTATGATCCACAGCTAGGAGACAAGATGGATTTTGGGTTTGAAGCCTCTCTAAGACTAGCATGCCCAACTGAGATTCCTTTGACAAACTTCACATTTGTGCCTAATGACA
TGACCCCAGTTATATTTGACAACCAGTATTACCGAGACATTATGATGGGGAGAGGCTTGTTTGGTATTGACTCCAGCATTTCTAGAGATCCTCGAACAGCACCCTTTGTCATGCGGTTTG
CTATGGATCAGAACTACTTCTTCAAGGCTTTCTCATCTGCATTTCTTAAACTTTCTTCTACCAATGTTCTCACAGATGTGCAGGGTGATGTCCGAAGGCAATGCAACCAGGTAAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GAAATATCTTTTCCTTGGATTCTGGTGGTCACAGTGGTCATGGCAATGNNNCCACTTTCATTTCGCATAAAAGCAAACCAACTTTCATACGACTACTACAAGTTTTCATGCCCAAACTTG
GAAAGCGTAATCAAGAGTGAGTTGCTAGGCATATTCTTGACAGATGCTACTGCACCAGCTGCATTTCTCAGGCTCATGTTTCATGACTGCCAAGTTCAAG
GATGTGATGCCTCAATTCTG
TTGGATTCCAACTACCTAGCTCACAGTCACAGCTCTGAAATGAAATCTTCAAGGAACTTTGGTATCAGAAAGCGGGAAACGATCAGCTACATTAAGTCAATATTAGAAGAAGAATGTCCG
GGCCAGGTTTCTTGTGCAGATATTATTGTATTAGCTGCTAAGGAATCAGTGTCATTCTCTGGAGGACCTCATATTGAGATCCCACTTGGAAGAAAAGATTCCAGAACTTGTAGTTTCCAT
GAGGCTGATGCTAAGCTTCCTTCACCAACAATAACGGTTGATGAATTTATATCGATTTTCATGTCTAAAGGAATGAACATTGAAGAGTCTGTATCCATTTTAG
GTGCACATACACTAGGG
ATTGGACACTGCTTCAACATTGTTGGTAGATTGTATGATCCACAGCTAGGAGACAAGATGGATTTTGGGTTTGAAGCCTCTCTAAGACTAGCATGCCCAACTGAGATTCCTTTGACAAAC
TTCACATTTGTGCCTAATGACATGACCCCAGTTATATTTGACAACCAGTATTACCGAGACATTATGATGGGGAGAGGCTTGTTTGGTATTGACTCCAGCATTTCTAGAGATCCTCGAACA
GCACCCTTTGTCATGCGGTTTGCTATGGATCAGAACTACTTCTTCAAGGCTTTCTCATCTGCATTTCTTAAACTTTCTTCTACCAATGTTCTCACAGATGTGCAGGGTGATGTCCGAAGG
CAATGCAACCAGGTAAACTAA

Retrieve as FASTA