Entry information : GmPrx328
Entry ID 9869
Creation 2011-11-29 (Qiang Li)
Last sequence changes 2011-12-13 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-12 (Christophe Dunand)
Peroxidase information: GmPrx328
Name GmPrx328
Class Class III peroxidase    [Orthogroup: Prx008]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx328
start..stop
S start..stop
GmPrx158 634 0 1..320 1..320
GmPrx80 554 0 1..320 1..324
LjPrx30 553 0 3..320 4..322
GmPrx61 552 0 1..320 1..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 46006035..46006247 213 N° 2 46005470..46005661 192 N° 3 46005175..46005340 166 N° 4 46004637..46005028 392
complement(join(46004637..46005028,46005175..46005340,46005470..46005661,4600603 5..46006247))


exon

Literature and cross-references GmPrx328
DNA ref. Phytozome 12:   Gm04 (46006247..46004637)
Protein sequence: GmPrx328
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   320 (296)
PWM (Da):   %s   34389.17 (31820.9)  
PI (pH):   %s   9.01 (9.11) Peptide Signal:   %s   cut: 25 range:25-320
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASFCSRLTICLALFVLIWGSANAQLSTNFYYHSCPNLFSSVKSTVQSAISKETRMGASLLRLFFHDCFVNGCDGSILLDDTSSFTGEKNANPNRNSARGFEVIDNIKSAVEKVCPGVVSCADILAIAARDSVQILGGPTWNVKLGRRDARTASQSAANNGIPAPTSNLNQLISRFSALGLSTKDLVALSGGHTIGQARCTNFRARIYNETNIETAFARTRQQSCPRTSGSGDNNLAPLDLQTPTSFDNYYFKNLVQKKGLLHSDQQLFNGGSTDSIVRGYSTNPGTFSSDFAAAMIKMGDISPLTGSNGEIRKNCRRIN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCGTTTTGTTCTAGATTGACAATTTGTTTGGCTCTGTTTGTCCTCATATGGGGGAGTGCCAATGCACAACTTTCTACAAACTTTTACTACCATTCATGTCCAAACCTCTTCTCC
TCTGTGAAATCCACAGTGCAATCTGCCATATCTAAGGAGACCCGCATGGGTGCTTCTCTCCTTCGCTTGTTCTTCCACGATTGCTTTGTCAAT
GTAATTTATTTGCACCTTCTCCCACTT
ACATACAAATATGCTAAGCTTACATATAGCTCCTCTTTCTACCACTTGCATGCATCATCTAATTTTGTTTGAAACAACACTTGTTCCTTTTATTATACACATCATCTTTGATAAAATTTT
GTCGTGTGCAACTTTTTTTTAGTGTGTTAATCAGTTCTATGATGATACTATTAGTTAAGAAATTTTAATGCACTTAATAAACCATTTTAAGTACTTTAACCGTTCAATGATATTATATAT
TTAAAGATAATAAATATTTCTGCTTTTGTTTCTATATTAGTGTAGTTAAGAACCTTCTTACTTCTTAGCTAGCTAAATATTAATGAGTAAACATTAACAAATGCAGGGATGTGATGGTTC
AATTCTATTGGATGACACATCAAGCTTCACCGGAGAGAAGAACGCAAACCCCAACAGGAACTCTGCTCGTGGATTCGAGGTTATTGACAACATTAAATCAGCCGTGGAGAAAGTGTGTCC
AGGAGTTGTTTCCTGCGCAGATATCCTTGCCATCGCTGCCAGAGACTCTGTTCAGATT
GTAAGTGGTCAAACAACCAACAAAAACACATTAAACTAAATCATTAAATTGTACATATCAAA
ATTAATTACCAATTTAGTACCACACATGCAATTAAAGAGAACATTTTGTTGATTTTGATCAATATAGCTTGGAGGCCCTACATGGAATGTTAAACTTGGAAGAAGAGACGCTAGAACTGC
TAGCCAATCTGCTGCTAACAATGGCATCCCTGCACCCACTTCAAACCTTAACCAACTCATCTCAAGATTTAGCGCTCTTGGACTTTCCACCAAGGACTTGGTCGCCTTGTCCG
GTACAAA
ACATATATCACATAATTTTCCAATTAATTACATTTCAATCATATAGTAAAATTTCTCAATTAATTAGGAACATGAGAAACTTATAGTCACACGTTCTTTTGTTGAGGAATATTGCATGGT
TTAATTTTGCTTTCATTAGGTGGTCACACAATTGGACAAGCAAGGTGCACAAACTTCAGAGCCCGCATCTACAACGAGACCAACATAGAAACCGCATTTGCAAGGACTAGGCAGCAAAGC
TGCCCTAGAACATCAGGGTCAGGGGACAACAATCTGGCACCACTTGATCTTCAAACTCCAACCAGCTTTGACAACTACTACTTCAAGAACCTCGTTCAGAAGAAGGGTCTCCTCCACTCT
GATCAGCAACTGTTCAACGGTGGGTCCACCGACTCCATTGTGCGTGGCTACAGCACCAACCCGGGCACCTTCTCCTCTGATTTCGCCGCCGCCATGATCAAGATGGGAGACATTAGTCCT
CTCACTGGCTCCAATGGAGAAATCAGGAAGAATTGTAGAAGGATTAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCGTTTTGTTCTAGATTGACAATTTGTTTGGCTCTGTTTGTCCTCATATGGGGGAGTGCCAATGCACAACTTTCTACAAACTTTTACTACCATTCATGTCCAAACCTCTTCTCC
TCTGTGAAATCCACAGTGCAATCTGCCATATCTAAGGAGACCCGCATGGGTGCTTCTCTCCTTCGCTTGTTCTTCCACGATTGCTTTGTCAAT
GGATGTGATGGTTCAATTCTATTGGAT
GACACATCAAGCTTCACCGGAGAGAAGAACGCAAACCCCAACAGGAACTCTGCTCGTGGATTCGAGGTTATTGACAACATTAAATCAGCCGTGGAGAAAGTGTGTCCAGGAGTTGTTTCC
TGCGCAGATATCCTTGCCATCGCTGCCAGAGACTCTGTTCAGATT
CTTGGAGGCCCTACATGGAATGTTAAACTTGGAAGAAGAGACGCTAGAACTGCTAGCCAATCTGCTGCTAACAAT
GGCATCCCTGCACCCACTTCAAACCTTAACCAACTCATCTCAAGATTTAGCGCTCTTGGACTTTCCACCAAGGACTTGGTCGCCTTGTCCG
GTGGTCACACAATTGGACAAGCAAGGTGC
ACAAACTTCAGAGCCCGCATCTACAACGAGACCAACATAGAAACCGCATTTGCAAGGACTAGGCAGCAAAGCTGCCCTAGAACATCAGGGTCAGGGGACAACAATCTGGCACCACTTGAT
CTTCAAACTCCAACCAGCTTTGACAACTACTACTTCAAGAACCTCGTTCAGAAGAAGGGTCTCCTCCACTCTGATCAGCAACTGTTCAACGGTGGGTCCACCGACTCCATTGTGCGTGGC
TACAGCACCAACCCGGGCACCTTCTCCTCTGATTTCGCCGCCGCCATGATCAAGATGGGAGACATTAGTCCTCTCACTGGCTCCAATGGAGAAATCAGGAAGAATTGTAGAAGGATTAAC
TAA

Retrieve as FASTA