Entry information : BcomDyPrx
Entry ID 9875
Creation 2011-12-05 (Christophe Dunand)
Last sequence changes 2011-12-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-23 (Catherine Mathe (Scipio))
Peroxidase information: BcomDyPrx
Name BcomDyPrx
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Baudoinia
Organism Baudoinia compniacensis    [TaxId: 430998 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BcomDyPrx
start..stop
S start..stop
MpopDyPrx 456 3e-158 3..454 2..484
MpiDyPrx01 449 3e-155 8..467 6..502
SpopDyPrx 358 6e-117 3..387 47..462
HanDyPrx01 332 1e-109 7..452 9..481
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 366704..366991 288 N° 2 367044..367315 272 N° 3 367369..368248 880  
join(366704..366991,367044..367315,367369..368248)


exon

Literature and cross-references BcomDyPrx
DNA ref. JGI genome:   scaffold_2 (366704..368248)
Protein sequence: BcomDyPrx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   480
PWM (Da):   %s   51770.4  
PI (pH):   %s   6.97
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGSTDSLNLDNIQGDILGDGLPKLSETFLFFTINDPRSFCQRLNQVSNEIASTTHVKDLRSGIANNAGGGIVPAVGANIAFSCHGLQKVTCSQASDLNTQDPAFDAGMKAGAASLADPLRSGSSDPAWEDVYLHPENVHGVILAAGSDDGICSQKLQTIMSIFGPSAGEVHRVSGKVRPGEMKGHEHFGYMDGVSQPAVQGIDTATPGQDIVSHGTFICGRNGDRFASQRPAWMIDGSFLCFRKLQQNVQDWNKFLVDASNQLGTWSDQLGSRLVGRWKSGCPIQLSPDFDDRNLAADPNRVNKFDFDSISNDFRCPMGAHIRKTNPRGDLGRATVNQFRILRRGIPYGNEVDADPTGERGLLFVCYQSNISQGFKFIQETWANQAVFASEGAGVDAIMGQSNSQKTINMRGLYPQDASRPLALSGINRFVVPKGGEYFFSPSMSALKTTLSTVREHGCTHQVGNHRSKATVPSITCHT

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTCCACAGACAGCCTGAACCTAGACAACATACAGGGAGACATCCTTGGTGATGGTCTGCCAAAGCTGAGTGAGACGTTCCTCTTCTTCACCATCAACGACCCAAGAAGCTTCTGC
CAGCGTCTCAACCAGGTCTCGAATGAAATCGCGAGCACAACACATGTCAAAGACTTGCGTAGCGGCATCGCAAATAATGCTGGCGGTGGCATCGTACCCGCCGTTGGCGCCAATATCGCT
TTCTCTTGCCACGGATTGCAGAAGGTGACGTGTTCGCAAGCCTCGGAT
GTGGCATCCCGTTGACTGGATGTGGATGTCTGGTGTCCTCCTTAACATCCAGCTTAACACGCAAGACCCTGC
GTTTGACGCCGGCATGAAGGCGGGTGCAGCATCGCTTGCAGATCCCCTCAGAAGCGGCTCCTCAGATCCAGCATGGGAGGACGTGTATCTGCATCCCGAGAACGTACATGGAGTCATCCT
AGCCGCCGGCAGTGATGACGGTATCTGCAGCCAGAAGCTGCAGACTATCATGAGCATCTTCGGCCCGTCTGCGGGAGAAGTGCATAGAGTGAGCGGCAAGGTTCGACCGGGCGAGATGAA
AGGCCATGAGCA
GTATGCAAGTCCCAGAGTCCTACACGTATAAGCATTCCTAACCTTGGAAGCAGCTTCGGATATATGGATGGGGTCTCGCAACCAGCCGTCCAGGGTATCGACACGGCG
ACTCCTGGTCAAGACATTGTCAGCCATGGCACGTTCATATGCGGGCGGAACGGCGATCGCTTCGCCAGCCAGCGCCCAGCTTGGATGATAGATGGGAGCTTTCTCTGTTTCCGGAAGCTG
CAACAGAATGTCCAGGACTGGAACAAATTTCTGGTCGATGCCTCCAATCAGCTTGGTACGTGGTCAGATCAGCTAGGTTCACGCTTGGTCGGACGATGGAAGAGTGGCTGCCCAATCCAG
CTGTCTCCGGACTTTGACGACAGAAATCTGGCGGCAGACCCCAATCGGGTCAACAAGTTTGACTTTGACAGCATCAGCAATGACTTTAGGTGCCCTATGGGCGCCCACATCCGCAAGACT
AATCCTCGTGGTGATCTTGGTCGAGCGACCGTCAACCAGTTCCGTATTCTGCGCCGTGGCATTCCTTATGGCAACGAAGTCGATGCCGACCCGACAGGAGAGCGTGGGCTGCTATTCGTC
TGCTACCAGAGCAATATCTCGCAGGGTTTCAAGTTCATTCAGGAGACCTGGGCCAACCAGGCTGTCTTCGCAAGCGAAGGCGCAGGTGTTGACGCAATCATGGGACAGAGCAACAGTCAG
AAGACTATCAACATGAGAGGGCTGTATCCACAAGATGCGTCACGACCACTAGCGCTATCCGGGATCAATCGGTTTGTGGTGCCGAAAGGTGGGGAGTACTTCTTTTCGCCTTCAATGAGC
GCTCTGAAGACGACACTATCGACAGTAAGGGAGCATGGTTGTACTCATCAGGTCGGGAATCATAGAAGTAAGGCAACAGTTCCCAGTATAACATGCCATACCCAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTCCACAGACAGCCTGAACCTAGACAACATACAGGGAGACATCCTTGGTGATGGTCTGCCAAAGCTGAGTGAGACGTTCCTCTTCTTCACCATCAACGACCCAAGAAGCTTCTGC
CAGCGTCTCAACCAGGTCTCGAATGAAATCGCGAGCACAACACATGTCAAAGACTTGCGTAGCGGCATCGCAAATAATGCTGGCGGTGGCATCGTACCCGCCGTTGGCGCCAATATCGCT
TTCTCTTGCCACGGATTGCAGAAGGTGACGTGTTCGCAAGCCTCGGAT
CTTAACACGCAAGACCCTGCGTTTGACGCCGGCATGAAGGCGGGTGCAGCATCGCTTGCAGATCCCCTCAGA
AGCGGCTCCTCAGATCCAGCATGGGAGGACGTGTATCTGCATCCCGAGAACGTACATGGAGTCATCCTAGCCGCCGGCAGTGATGACGGTATCTGCAGCCAGAAGCTGCAGACTATCATG
AGCATCTTCGGCCCGTCTGCGGGAGAAGTGCATAGAGTGAGCGGCAAGGTTCGACCGGGCGAGATGAAAGGCCATGAGCA
CTTCGGATATATGGATGGGGTCTCGCAACCAGCCGTCCAG
GGTATCGACACGGCGACTCCTGGTCAAGACATTGTCAGCCATGGCACGTTCATATGCGGGCGGAACGGCGATCGCTTCGCCAGCCAGCGCCCAGCTTGGATGATAGATGGGAGCTTTCTC
TGTTTCCGGAAGCTGCAACAGAATGTCCAGGACTGGAACAAATTTCTGGTCGATGCCTCCAATCAGCTTGGTACGTGGTCAGATCAGCTAGGTTCACGCTTGGTCGGACGATGGAAGAGT
GGCTGCCCAATCCAGCTGTCTCCGGACTTTGACGACAGAAATCTGGCGGCAGACCCCAATCGGGTCAACAAGTTTGACTTTGACAGCATCAGCAATGACTTTAGGTGCCCTATGGGCGCC
CACATCCGCAAGACTAATCCTCGTGGTGATCTTGGTCGAGCGACCGTCAACCAGTTCCGTATTCTGCGCCGTGGCATTCCTTATGGCAACGAAGTCGATGCCGACCCGACAGGAGAGCGT
GGGCTGCTATTCGTCTGCTACCAGAGCAATATCTCGCAGGGTTTCAAGTTCATTCAGGAGACCTGGGCCAACCAGGCTGTCTTCGCAAGCGAAGGCGCAGGTGTTGACGCAATCATGGGA
CAGAGCAACAGTCAGAAGACTATCAACATGAGAGGGCTGTATCCACAAGATGCGTCACGACCACTAGCGCTATCCGGGATCAATCGGTTTGTGGTGCCGAAAGGTGGGGAGTACTTCTTT
TCGCCTTCAATGAGCGCTCTGAAGACGACACTATCGACAGTAAGGGAGCATGGTTGTACTCATCAGGTCGGGAATCATAGAAGTAAGGCAACAGTTCCCAGTATAACATGCCATACCCAG

Retrieve as FASTA