Entry information : PstrDyPrx05 (DyP5)
Entry ID 9880
Creation 2011-12-05 (Christophe Dunand)
Last sequence changes 2011-12-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-03 (Catherine Mathe (Scipio))
Peroxidase information: PstrDyPrx05 (DyP5)
Name (synonym) PstrDyPrx05 (DyP5)
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Punctularia
Organism Punctularia strigosozonata    [TaxId: 202698 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PstrDyPrx05
start..stop
S start..stop
PstrDyPrx02 800 0 1..507 1..510
PbreDyPrx01 541 0 37..507 33..503
PbreDyPrx03 530 0 38..507 34..503
PbreDyPrx02 514 4e-180 41..507 37..504
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1575820..1575952 133 N° 2 1575677..1575767 91 N° 3 1575179..1575624 446 N° 4 1574543..1575124 582
N° 5 1574203..1574474 272  
complement(join(1574203..1574474,1574543..1575124,1575179..1575624,1575677..1575 767,1575820..1575952))


exon

Literature and cross-references PstrDyPrx05 (DyP5)
DNA ref. JGI genome:   scaffold_10 (1575952..1574203)
Protein sequence: PstrDyPrx05 (DyP5)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   507 (485)
PWM (Da):   %s   54209.24 (51882.0)  
PI (pH):   %s   4.6 (4.55) Peptide Signal:   %s   cut: 23 range:23-507
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MQYPRLLAFAILAVNNVGGVLSAAVAERAVHARAASGRTTPLLKDFKGQPPLPTLASVEAANGTLDLTNIQGDILVGMKKPVESFFFFHINDPAQFKTDMKNQLSVIASVATLISPPAQQPAAYVNVAFSQSGLTTLGITDDLGDAAFTTGQFADAENLNDDITQWQSEFKGTNIHGVFLVCSDVGTNIESVFNSSIQVLMNSTSIVFQLDGAARPGDQAGHHFGYLDGISNPGITDFTTNPFPGQSVVQNGILLLGEDGDTITRPAWAVDGSFLAFRKLRQFVPEYNKFLLDNAVQSPAGNLTQQQGADLLGARLIGRWPSGAPVDLTPMADDPELGADATRNNNFDYTHPDSNITSDQSHCPFTAHLRKVRPRADLNDTNVINQAIRAGLPYGPEVTAEEAASNTSSIDRGLAFVMYQSNIENGFRFQQTKWSSNANFIFGKNITSVGLDLVIGQAGPGLTRNNTGLDPTNFNKVIVQTPTVVSNGGEYFFSPSISALQNTILA

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAGTATCCGCGCTTGCTCGCTTTCGCTATACTCGCCGTCAACAATGTTGGCGGCGTACTCAGCGCCGCCGTCGCTGAGCGAGCTGTCCATGCTCGCGCTGCCAGCGGGAGGACGACA
CCCCTGCTCAAGG
GTAGGCATTCGACCATGTCACCATGCTCCACTGACCAATCTCTCGCATTCAGATTTTAAGGGACAGCCTCCGTTGCCGACTCTTGCGTCGGTTGAGGCTGCAAACGG
AACCTTGGATCTCACAAATATCCAGGGCGATATCCT
GTACGTGCTTCCACAGCATACAACACCAGTACACTGACCGTACTTCTTCCAGGGTCGGCATGAAGAAGCCCGTTGAAAGTTTTT
TCTTCTTCCACATCAACGATCCTGCTCAGTTCAAGACCGATATGAAGAACCAGCTTTCGGTCATTGCCTCGGTGGCCACCTTGATCTCTCCCCCCGCTCAGCAGCCTGCCGCATATGTCA
ATGTTGCGTTTTCTCAGAGCGGCCTGACCACGCTCGGGATCACAGATGACCTCGGTGACGCCGCCTTCACCACCGGTCAATTCGCGGACGCTGAGAACTTGAATGACGACATCACGCAAT
GGCAGTCCGAGTTTAAGGGTACCAACATTCACGGCGTCTTCCTCGTCTGCAGCGACGTCGGTACGAACATCGAGAGCGTATTCAACAGCTCGATTCAGGTCTTGATGAATTCCACCTCCA
TCGTGTTCCAACTCGATGGCGCTGCTCGCCCCGGTGATCAGGCTGGCCACGAGC
GTGAGTATTTTGCTGCTCGGACCATGGAATGCCCAGCTGACGTCCGCGATCCAGACTTCGGGTACT
TGGACGGCATCTCCAACCCGGGTATCACAGACTTCACCACGAATCCCTTCCCGGGCCAATCCGTCGTTCAAAACGGCATCCTTCTCCTCGGAGAGGACGGCGACACGATCACGCGCCCGG
CATGGGCCGTCGACGGCTCCTTCCTCGCCTTCCGCAAGCTCAGACAGTTCGTGCCCGAGTACAACAAGTTCCTCCTCGACAACGCCGTTCAGAGCCCCGCCGGCAATCTCACCCAGCAGC
AGGGCGCCGATCTCCTCGGTGCCCGCCTGATCGGACGCTGGCCCAGCGGCGCCCCCGTCGACCTTACCCCGATGGCCGACGACCCCGAGCTCGGCGCGGACGCCACCCGCAACAACAACT
TCGACTACACCCACCCCGACTCGAACATCACGAGCGACCAGTCGCACTGCCCGTTCACCGCGCACCTCCGCAAGGTGCGCCCGCGCGCCGACCTGAATGACACGAACGTCATCAACCAGG
CGATCCGCGCCGGCCTGCCTTATGGCCCCGAAGTGACGGCCGAGGAGGCCGCTTCGAATACGTCGTCGATCGACCGCGGCCTCGCCTTCG
GTGAGCACTCACAATTTCTCCCGCAAGCGC
AGGTTTTCCGCGATGCTCACCGGCGCCTTTCCCCACAGTCATGTACCAATCGAACATTGAGAACGGTTTCCGCTTCCAGCAGACGAAGTGGTCCAGCAACGCCAACTTCATTTTCGGCAA
GAACATCACTTCCGTGGGTCTCGATCTCGTCATCGGCCAGGCCGGCCCCGGCCTCACGCGCAACAACACCGGCTTGGACCCGACCAACTTCAACAAGGTCATCGTCCAGACCCCGACCGT
CGTTTCCAACGGCGGCGAGTACTTCTTCTCCCCTTCAATCTCGGCGCTACAAAACACCATCTTGGCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAGTATCCGCGCTTGCTCGCTTTCGCTATACTCGCCGTCAACAATGTTGGCGGCGTACTCAGCGCCGCCGTCGCTGAGCGAGCTGTCCATGCTCGCGCTGCCAGCGGGAGGACGACA
CCCCTGCTCAAGG
ATTTTAAGGGACAGCCTCCGTTGCCGACTCTTGCGTCGGTTGAGGCTGCAAACGGAACCTTGGATCTCACAAATATCCAGGGCGATATCCTGGTCGGCATGAAGAAG
CCCGTTGAAAGTTTTTTCTTCTTCCACATCAACGATCCTGCTCAGTTCAAGACCGATATGAAGAACCAGCTTTCGGTCATTGCCTCGGTGGCCACCTTGATCTCTCCCCCCGCTCAGCAG
CCTGCCGCATATGTCAATGTTGCGTTTTCTCAGAGCGGCCTGACCACGCTCGGGATCACAGATGACCTCGGTGACGCCGCCTTCACCACCGGTCAATTCGCGGACGCTGAGAACTTGAAT
GACGACATCACGCAATGGCAGTCCGAGTTTAAGGGTACCAACATTCACGGCGTCTTCCTCGTCTGCAGCGACGTCGGTACGAACATCGAGAGCGTATTCAACAGCTCGATTCAGGTCTTG
ATGAATTCCACCTCCATCGTGTTCCAACTCGATGGCGCTGCTCGCCCCGGTGATCAGGCTGGCCACGAGC
ACTTCGGGTACTTGGACGGCATCTCCAACCCGGGTATCACAGACTTCACC
ACGAATCCCTTCCCGGGCCAATCCGTCGTTCAAAACGGCATCCTTCTCCTCGGAGAGGACGGCGACACGATCACGCGCCCGGCATGGGCCGTCGACGGCTCCTTCCTCGCCTTCCGCAAG
CTCAGACAGTTCGTGCCCGAGTACAACAAGTTCCTCCTCGACAACGCCGTTCAGAGCCCCGCCGGCAATCTCACCCAGCAGCAGGGCGCCGATCTCCTCGGTGCCCGCCTGATCGGACGC
TGGCCCAGCGGCGCCCCCGTCGACCTTACCCCGATGGCCGACGACCCCGAGCTCGGCGCGGACGCCACCCGCAACAACAACTTCGACTACACCCACCCCGACTCGAACATCACGAGCGAC
CAGTCGCACTGCCCGTTCACCGCGCACCTCCGCAAGGTGCGCCCGCGCGCCGACCTGAATGACACGAACGTCATCAACCAGGCGATCCGCGCCGGCCTGCCTTATGGCCCCGAAGTGACG
GCCGAGGAGGCCGCTTCGAATACGTCGTCGATCGACCGCGGCCTCGCCTTCG
TCATGTACCAATCGAACATTGAGAACGGTTTCCGCTTCCAGCAGACGAAGTGGTCCAGCAACGCCAAC
TTCATTTTCGGCAAGAACATCACTTCCGTGGGTCTCGATCTCGTCATCGGCCAGGCCGGCCCCGGCCTCACGCGCAACAACACCGGCTTGGACCCGACCAACTTCAACAAGGTCATCGTC
CAGACCCCGACCGTCGTTTCCAACGGCGGCGAGTACTTCTTCTCCCCTTCAATCTCGGCGCTACAAAACACCATCTTGGCTTAG

Retrieve as FASTA