Entry information : PstrDyPrx01 (DyP1)
Entry ID 9881
Creation 2011-12-05 (Christophe Dunand)
Last sequence changes 2011-12-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-03 (Catherine Mathe (Scipio))
Peroxidase information: PstrDyPrx01 (DyP1)
Name (synonym) PstrDyPrx01 (DyP1)
Class DyP-type peroxidase D    [Orthogroup: DyPrxD004]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Punctularia
Organism Punctularia strigosozonata    [TaxId: 202698 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PstrDyPrx01
start..stop
S start..stop
PstrDyPrx03 608 0 35..503 27..505
PbreDyPrx01 526 0 40..505 34..503
BaDyPrx02 495 4e-173 40..504 28..494
PstrDyPrx02 489 3e-170 5..505 6..510
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 767597..767735 139 N° 2 767433..767535 103 N° 3 767296..767382 87 N° 4 766992..767243 252
N° 5 766802..766940 139 N° 6 766637..766751 115 N° 7 766550..766583 34 N° 8 766401..766493 93
N° 9 766322..766343 22 N° 10 766202..766271 70 N° 11 766031..766142 112 N° 12 765930..765955 26
N° 13 765822..765878 57 N° 14 765696..765762 67 N° 15 765440..765641 202  
complement(join(765440..765641,765696..765762,765822..765878,765930..765955,7660 31..766142,766202..766271,766322..766343,766401..766493,766550..766583,766637..7 66751,766802..766940,766992..767243,767296..767382,767433..767535,767597..767735 ))


exon

Literature and cross-references PstrDyPrx01 (DyP1)
DNA ref. JGI genome:   scaffold_9 (767735..765440)
Protein sequence: PstrDyPrx01 (DyP1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   505 (482)
PWM (Da):   %s   54887.09 (52323.7)  
PI (pH):   %s   5 (4.82) Peptide Signal:   %s   cut: 24 range:24-505
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRNLFFVLYLCGLAHLGFLLGNASPPPQRGGRQRRQDIVRDVPLLIDYPGQTLLPAIEDILFLNLTNGSFITTDNIQGDILIGMKKPKETFLFFHINDAATFKSVLKNNIYPEITTTTQLISPPSAQPLALLNIAFTASGLEALNVLDPLGDLVYPGGQYADAGDLGDVTSNWEDAFKGTDTHGVFLIGSDQITYVNDLIDDILSWLGPAITVRDRIDGAARPGAEAGHEHFGFLDGISPGVGGFVTNLMPGQQLVLPGTILTGHLGDVGLRPLWARDGSFLVFRKLQQYVPEFNKYLQDNAIQHPGLSPAQGAELLGARMVGRWKGAPIDLFPTADNPAIGADPTHNNDFTYNHPLPFLLPTDQTYCPWTAHIRKTRPRADEVDVKAGIPYGPVTADEAKSNTTKTDRGLAFVAYQSNIALGYRFQQTLWSNSQIFPPAKLDLSPGFDPLIGQNSGGTRTAGGLNPYDQTRDYVLKDFIVSRGGDYFFSPSLSAIHDVISA

Retrieve as FASTA  
Remarks Complete sequence from genomic (14 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGCAACCTTTTCTTCGTTCTGTATCTGTGCGGCCTCGCGCACCTAGGCTTTCTTCTTGGGAATGCCTCGCCTCCACCGCAGAGGGGTGGGCGTCAGCGACGCCAAGATATTGTCCGC
GACGTGCCACTCCTGATTG
GTCGGTTGCTGCACCGTCGTCCGCCGGGTTTGCACTCATCTCTCGTCGCTGTCTGCTCCAGACTATCCGGGACAGACCCTTTTACCAGCGATTGAGGACAT
TTTGTTCCTCAATCTCACGAATGGCTCCTTCATCACCACGGACAATATCCAGGGGGACATTCT
GTTAGTTTGTCGGCCATGATTAGCCTTGGTGGCGAGCTCACAAATCATAGTATCGGG
ATGAAGAAACCAAAGGAAACGTTCCTGTTCTTCCATATCAATGATGCAGCAACCTTCAAGTCTGTCCTGAAAAATAACAT
GTCAGTCCCATTGACGATATAACAGGTTTACTGCCGCTGA
TGCTTGATGCAGCTACCCGGAAATCACGACGACCACGCAACTTATCTCGCCCCCATCGGCGCAGCCGCTGGCCCTCCTCAACATTGCTTTCACCGCGTCCGGGCTCGAAGCGTTGAACGT
GCTCGATCCCCTTGGGGATTTGGTGTATCCTGGTGGGCAGTACGCAGACGCTGGCGACCTTGGCGATGTCACTAGCAATTGGGAGGACGCGTTCAAGGGAACGGACACACACGGCGTATT
CCTGATCGGTTCTGACCAAATAAC
GTAAGATACCCGATTCATTTCCACAGACAGCCTAAACAACACGATTTGTAGGTATGTGAACGATTTGATTGACGACATCCTGTCTTGGCTTGGACC
AGCCATAACTGTGCGCGACCGCATTGACGGCGCAGCGAGGCCCGGTGCGGAGGCAGGACATGAACACTTCGGCTTCCTTGATGGCATTAGTCAG
GTTCGTTCCCATTGCAGAACCTTGCA
CCGATGCTCATAGCTCCATGTCAGCCTGGTGTCGGAGGATTTGTCACGAATTTGATGCCTGGACAACAACTCGTCCTTCCGGGTACCATCCTGACCGGCCACCTGGGAGATGTCGGCCTT
CGGCCGCTGTGGGCGAGAG
GCAAGATGTCCATTCCACGGTGGCAGTATAATAAACGCTCAAATTTTACACAGATGGCAGTTTCCTCGTTTTCCGTAAACTTCAACAGTGAGGAACCCCTC
AACAGCAGTGATCTGGATCTCCCCTGACGCAGCGAACGACAGATACGTTCCCGAATTTAACAAATATTTGCAAGACAATGCCATTCAGCATCCAGGGCTTTCGCCGGCCCAGGGAGCTGA
ATTACTAGGTGCTCG
GTGAGTCGACTAGTCAATATTCAGGATCTGCGAGTAGTGCCTGACAGCATGCACTAGCATGGTTGGACGATGGAAATCTGTAGGATGATTTCGCAGCGCCACGAA
ACTTGACTTAGTTCTTACTTCCAGGGAGCTCCCATCGATCTGTTCCCTACTGCGGACAACCCGGCCATCGGTGCTGACCCAACTCACAACAACGGCGAGTACAATCATGTTGATCAACAC
GCTATATTGCAATAACATGGCCATCCTGGGTAGATTTCACGTACAACCATCCTCTTCCGTTCCTACTCCCCACCGATCAGACATACTGCCCATGGACCGCTCACATCAGGAAGACGCGTC
CCAGAGCCGACGAGGTGGATGTCAA
GTAAGCCTTATGGAGCCATAGGTCGCGTTTTGGAGGCTGACAGCGATTCAACAGCTCTATTAACGTCATCATCAGAGCAGGAATTCCGTATGGTC
CCGAAG
GCGAGTAGGGGCAGCCTGAAATTGAGCTTCAGCATTGAGAGCCCAAAATAGTTACCGCAGATGAAGCCAAATCAAATACTACGAAGACGGATCGCGGCCTGGCCTTCGGTGAGA
TTGATAGTGAAACGAATGGGAGAATCCGAGAATCCAATTGAACATCCCTGCAGTTGCCTACCAGAGCAATATCGCCCTTGGGTATCGTTTCCAGCAAACCCTTTGGTCAAATTCCCAGAT
GTGCGCCAATATCAGTTCTTCCGATCAGCTCATGTTGACGCGCCCGTATACTAGTTTCCCGCCAGCGAAACTCGATCTATCACCCGGCTTCGATCCATTGATTGGCCAGAATAGCGGAGG
CACTCGTACTGCTGGCGGCCTTAACCCTTATGACCAGACGAGGGACTACGTGCTGAAGGACTTCATTGTTAGCCGTGGTGGAGACTACTTCTTCTCGCCCTCGCTTTCCGCAATCCATGA
TGTGATCAGTGCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGCAACCTTTTCTTCGTTCTGTATCTGTGCGGCCTCGCGCACCTAGGCTTTCTTCTTGGGAATGCCTCGCCTCCACCGCAGAGGGGTGGGCGTCAGCGACGCCAAGATATTGTCCGC
GACGTGCCACTCCTGATTG
ACTATCCGGGACAGACCCTTTTACCAGCGATTGAGGACATTTTGTTCCTCAATCTCACGAATGGCTCCTTCATCACCACGGACAATATCCAGGGGGACATT
CT
TATCGGGATGAAGAAACCAAAGGAAACGTTCCTGTTCTTCCATATCAATGATGCAGCAACCTTCAAGTCTGTCCTGAAAAATAACATCTACCCGGAAATCACGACGACCACGCAACTT
ATCTCGCCCCCATCGGCGCAGCCGCTGGCCCTCCTCAACATTGCTTTCACCGCGTCCGGGCTCGAAGCGTTGAACGTGCTCGATCCCCTTGGGGATTTGGTGTATCCTGGTGGGCAGTAC
GCAGACGCTGGCGACCTTGGCGATGTCACTAGCAATTGGGAGGACGCGTTCAAGGGAACGGACACACACGGCGTATTCCTGATCGGTTCTGACCAAATAAC
GTATGTGAACGATTTGATT
GACGACATCCTGTCTTGGCTTGGACCAGCCATAACTGTGCGCGACCGCATTGACGGCGCAGCGAGGCCCGGTGCGGAGGCAGGACATGAACACTTCGGCTTCCTTGATGGCATTAGTCAG
CCTGGTGTCGGAGGATTTGTCACGAATTTGATGCCTGGACAACAACTCGTCCTTCCGGGTACCATCCTGACCGGCCACCTGGGAGATGTCGGCCTTCGGCCGCTGTGGGCGAGAGATGGC
AGTTTCCTCGTTTTCCGTAAACTTCAACA
ATACGTTCCCGAATTTAACAAATATTTGCAAGACAATGCCATTCAGCATCCAGGGCTTTCGCCGGCCCAGGGAGCTGAATTACTAGGTGCT
CG
CATGGTTGGACGATGGAAATCTGGAGCTCCCATCGATCTGTTCCCTACTGCGGACAACCCGGCCATCGGTGCTGACCCAACTCACAACAACGATTTCACGTACAACCATCCTCTTCCG
TTCCTACTCCCCACCGATCAGACATACTGCCCATGGACCGCTCACATCAGGAAGACGCGTCCCAGAGCCGACGAGGTGGATGTCAA
AGCAGGAATTCCGTATGGTCCCGAAGTTACCGCA
GATGAAGCCAAATCAAATACTACGAAGACGGATCGCGGCCTGGCCTTCG
TTGCCTACCAGAGCAATATCGCCCTTGGGTATCGTTTCCAGCAAACCCTTTGGTCAAATTCCCAGATTTTC
CCGCCAGCGAAACTCGATCTATCACCCGGCTTCGATCCATTGATTGGCCAGAATAGCGGAGGCACTCGTACTGCTGGCGGCCTTAACCCTTATGACCAGACGAGGGACTACGTGCTGAAG
GACTTCATTGTTAGCCGTGGTGGAGACTACTTCTTCTCGCCCTCGCTTTCCGCAATCCATGATGTGATCAGTGCGTGA

Retrieve as FASTA